Detailed information NTG0449088

Bioinformatically predicted

Overview

• Name: comGG
• Type: Machinery gene
• Locus tag: ST4021_RS08855
• Genome accession: NZ_CP065493
• Coordinates: 1715858..1716175 (-)
• Length: 105 a.a.
• NCBI ID: WP_011681685.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain 4021
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1710858..1721175

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ST4021_RS08820 (ST4021_08850)	-	1711217..1711879 (-)	663	WP_011681679.1	type II CAAX endopeptidase family protein	-
ST4021_RS08825 (ST4021_08855)	-	1711976..1712419 (-)	444	WP_011681680.1	hypothetical protein	-
ST4021_RS08830	-	1712493..1712831 (-)	339	WP_224103197.1	CPBP family intramembrane glutamic endopeptidase	-
ST4021_RS08835	-	1712875..1713150 (-)	276	WP_011681681.1	hypothetical protein	-
ST4021_RS08840 (ST4021_08865)	-	1713162..1713359 (-)	198	WP_011681682.1	helix-turn-helix transcriptional regulator	-
ST4021_RS08845 (ST4021_08870)	-	1713608..1714801 (-)	1194	WP_014608740.1	acetate kinase	-
ST4021_RS08850 (ST4021_08875)	comGH	1714857..1715813 (-)	957	WP_011681684.1	class I SAM-dependent methyltransferase	Machinery gene
ST4021_RS08855 (ST4021_08880)	comGG	1715858..1716175 (-)	318	WP_011681685.1	competence type IV pilus minor pilin ComGG	Machinery gene
ST4021_RS08860 (ST4021_08885)	comGF	1716153..1716590 (-)	438	WP_011681686.1	competence type IV pilus minor pilin ComGF	Machinery gene
ST4021_RS08865 (ST4021_08890)	comGE	1716574..1716867 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	Machinery gene
ST4021_RS08870 (ST4021_08895)	comGD	1716839..1717267 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
ST4021_RS08875 (ST4021_08900)	comGC	1717227..1717553 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
ST4021_RS08880 (ST4021_08905)	comGB	1717550..1718650 (-)	1101	WP_120764773.1	competence type IV pilus assembly protein ComGB	Machinery gene
ST4021_RS08885 (ST4021_08910)	comGA	1718532..1719473 (-)	942	WP_014622005.1	competence type IV pilus ATPase ComGA	Machinery gene
ST4021_RS08890 (ST4021_08915)	-	1719554..1719916 (-)	363	WP_023909982.1	DUF1033 family protein	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11851.01 Da
• Isoelectric Point: 10.6334

>NTDB_id=449088 ST4021_RS08855 WP_011681685.1 1715858..1716175(-) (comGG) [Streptococcus thermophilus strain 4021]
MLLKKQVRGGVLLYALFMAGIFILLLQVYLERVVASSRQNQAQIVASQSRLMAEMTMDLVDKEAGAFSFSQGTTTYEVKG
KQVVVRVVSKGQIKTYRYVKKQDQK

Nucleotide

• Length: 318 bp

>NTDB_id=449088 ST4021_RS08855 WP_011681685.1 1715858..1716175(-) (comGG) [Streptococcus thermophilus strain 4021]
ATGCTTTTGAAAAAACAGGTTAGGGGAGGCGTTCTTCTCTACGCTCTTTTTATGGCTGGCATTTTTATACTCCTTCTTCA
GGTTTATCTGGAACGGGTGGTAGCTAGCTCTAGACAAAACCAAGCGCAAATAGTGGCCAGTCAAAGCCGTCTCATGGCAG
AGATGACTATGGACTTGGTGGATAAGGAAGCAGGTGCTTTTAGTTTTTCTCAGGGGACTACGACTTACGAGGTTAAGGGT
AAGCAAGTGGTTGTCAGAGTTGTCAGTAAAGGCCAAATCAAGACCTATCGTTATGTGAAGAAACAAGATCAGAAATAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGG	Streptococcus mutans UA140	45.455	94.286	0.429
comGG	Streptococcus mutans UA159	45.455	94.286	0.429
comGG/cglG	Streptococcus pneumoniae Rx1	43.333	85.714	0.371
comGG/cglG	Streptococcus pneumoniae TIGR4	43.333	85.714	0.371
comGG/cglG	Streptococcus pneumoniae D39	43.333	85.714	0.371
comGG/cglG	Streptococcus pneumoniae R6	43.333	85.714	0.371
comGG/cglG	Streptococcus mitis NCTC 12261	42.222	85.714	0.362