Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   HNS37_RS04895 Genome accession   NZ_CP053681
Coordinates   1057920..1058450 (+) Length   176 a.a.
NCBI ID   WP_060558092.1    Uniprot ID   -
Organism   Proteus mirabilis strain M3-1-17     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1014901..1064499 1057920..1058450 within 0


Gene organization within MGE regions


Location: 1014901..1064499
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HNS37_RS04580 - 1014901..1015119 (+) 219 WP_060556896.1 DNA polymerase III subunit theta -
  HNS37_RS04585 - 1015226..1015588 (+) 363 WP_060556897.1 GtrA family protein -
  HNS37_RS04590 - 1015588..1016505 (+) 918 WP_060556898.1 glycosyltransferase family 2 protein -
  HNS37_RS04595 - 1016505..1017959 (+) 1455 WP_060556899.1 glucosyltransferase domain-containing protein -
  HNS37_RS04600 - 1018016..1018786 (-) 771 WP_124725225.1 hypothetical protein -
  HNS37_RS04605 - 1018798..1020042 (-) 1245 WP_124725226.1 glycerophosphodiester phosphodiesterase family protein -
  HNS37_RS04610 - 1020100..1022568 (-) 2469 WP_060556902.1 host specificity factor TipJ family phage tail protein -
  HNS37_RS04615 - 1022555..1022947 (-) 393 WP_060556903.1 NlpC/P60 family protein -
  HNS37_RS04620 - 1022944..1023414 (-) 471 WP_060556904.1 DUF1833 family protein -
  HNS37_RS04625 - 1023414..1023890 (-) 477 WP_060556905.1 hypothetical protein -
  HNS37_RS04630 - 1023894..1027070 (-) 3177 WP_155195932.1 hypothetical protein -
  HNS37_RS04635 - 1027138..1027860 (-) 723 WP_060556273.1 hypothetical protein -
  HNS37_RS04640 - 1027983..1028858 (-) 876 WP_241681736.1 Rha family transcriptional regulator -
  HNS37_RS18185 - 1028855..1029424 (-) 570 WP_241681737.1 BRO family protein -
  HNS37_RS04650 - 1029494..1029664 (-) 171 WP_155195934.1 hypothetical protein -
  HNS37_RS04655 - 1029762..1030085 (+) 324 WP_172767708.1 Arc family DNA-binding protein -
  HNS37_RS04660 - 1030158..1030850 (-) 693 WP_060556627.1 DUF6246 family protein -
  HNS37_RS04665 - 1030900..1031655 (-) 756 WP_060556626.1 Ig-like domain-containing protein -
  HNS37_RS04670 - 1031729..1032097 (-) 369 WP_060556625.1 hypothetical protein -
  HNS37_RS04675 - 1032094..1032462 (-) 369 WP_049257616.1 hypothetical protein -
  HNS37_RS04680 - 1032464..1032817 (-) 354 WP_239685724.1 hypothetical protein -
  HNS37_RS04685 - 1032802..1033200 (-) 399 WP_060556623.1 hypothetical protein -
  HNS37_RS04690 - 1033257..1033430 (-) 174 WP_060556622.1 hypothetical protein -
  HNS37_RS04695 - 1033440..1034534 (-) 1095 WP_060556621.1 major capsid protein -
  HNS37_RS04700 - 1034547..1034996 (-) 450 WP_060556620.1 hypothetical protein -
  HNS37_RS04705 - 1034996..1036270 (-) 1275 WP_060556619.1 hypothetical protein -
  HNS37_RS04710 - 1036274..1037203 (-) 930 WP_060556618.1 phage minor head protein -
  HNS37_RS04715 - 1037154..1038509 (-) 1356 WP_060556617.1 phage portal protein -
  HNS37_RS04720 - 1038509..1039759 (-) 1251 WP_060556616.1 phage terminase large subunit -
  HNS37_RS04725 - 1039743..1040168 (-) 426 WP_060556615.1 DNA-packaging protein -
  HNS37_RS04730 - 1040185..1040370 (-) 186 WP_124725282.1 hypothetical protein -
  HNS37_RS04735 - 1040401..1040760 (-) 360 WP_036905461.1 hypothetical protein -
  HNS37_RS04740 - 1040741..1041523 (-) 783 WP_036905457.1 KilA-N domain-containing protein -
  HNS37_RS04750 - 1042104..1042505 (-) 402 WP_060556604.1 hypothetical protein -
  HNS37_RS04755 - 1042502..1042906 (-) 405 WP_060556605.1 structural protein -
  HNS37_RS04760 - 1042899..1043186 (-) 288 WP_036970165.1 phage holin family protein -
  HNS37_RS04765 - 1043183..1043572 (-) 390 WP_004916901.1 putative holin -
  HNS37_RS04770 - 1043707..1044474 (-) 768 WP_060556606.1 KilA-N domain-containing protein -
  HNS37_RS04775 - 1044951..1045790 (-) 840 WP_060556907.1 antitermination protein -
  HNS37_RS04780 - 1045787..1045987 (-) 201 WP_060556908.1 NinH -
  HNS37_RS04785 - 1045977..1046570 (-) 594 WP_060556909.1 recombination protein NinG -
  HNS37_RS04790 - 1046682..1046906 (-) 225 WP_060556914.1 DUF3310 domain-containing protein -
  HNS37_RS04795 - 1046912..1047358 (-) 447 WP_155195940.1 recombination protein NinB -
  HNS37_RS04800 - 1047769..1047996 (-) 228 WP_131728024.1 hypothetical protein -
  HNS37_RS04805 - 1047993..1048217 (-) 225 WP_060556611.1 DUF551 domain-containing protein -
  HNS37_RS04810 - 1048268..1048435 (-) 168 WP_152964332.1 hypothetical protein -
  HNS37_RS04815 rdgC 1048455..1049366 (-) 912 WP_060556819.1 recombination-associated protein RdgC -
  HNS37_RS04820 - 1049377..1050063 (-) 687 WP_060556820.1 replication protein P -
  HNS37_RS04825 - 1050060..1050998 (-) 939 WP_060556821.1 replication protein -
  HNS37_RS04830 - 1050995..1051690 (-) 696 WP_060556822.1 DNA-binding protein -
  HNS37_RS04835 - 1051712..1052044 (-) 333 WP_060556823.1 CII family transcriptional regulator -
  HNS37_RS04840 - 1052180..1052365 (-) 186 WP_036895075.1 Cro/CI family transcriptional regulator -
  HNS37_RS04845 - 1052461..1053171 (+) 711 WP_060556824.1 LexA family transcriptional regulator -
  HNS37_RS04850 - 1053325..1053735 (+) 411 WP_060556825.1 hypothetical protein -
  HNS37_RS04855 - 1054109..1054381 (+) 273 WP_115370313.1 hypothetical protein -
  HNS37_RS04860 - 1054403..1054900 (-) 498 WP_060557708.1 hypothetical protein -
  HNS37_RS04865 - 1055100..1055669 (+) 570 WP_060557707.1 hypothetical protein -
  HNS37_RS04870 - 1055890..1056165 (+) 276 WP_058336156.1 hypothetical protein -
  HNS37_RS04875 - 1056162..1056314 (+) 153 WP_175212394.1 hypothetical protein -
  HNS37_RS04880 - 1056311..1056631 (+) 321 WP_060558097.1 hypothetical protein -
  HNS37_RS04885 exoX 1056633..1057310 (+) 678 WP_060558095.1 exodeoxyribonuclease X -
  HNS37_RS04890 - 1057303..1057920 (+) 618 WP_060558093.1 ERF family protein -
  HNS37_RS04895 ssb 1057920..1058450 (+) 531 WP_060558092.1 single-stranded DNA-binding protein Machinery gene
  HNS37_RS04900 - 1058501..1058719 (+) 219 WP_049210558.1 hypothetical protein -
  HNS37_RS04905 - 1058750..1059037 (+) 288 WP_060558090.1 cyclic-phosphate processing receiver domain-containing protein -
  HNS37_RS04910 - 1059037..1059306 (+) 270 WP_060558088.1 hypothetical protein -
  HNS37_RS04915 - 1059299..1059544 (+) 246 WP_049211072.1 hypothetical protein -
  HNS37_RS04920 - 1059703..1060068 (+) 366 WP_060558087.1 DUF2528 family protein -
  HNS37_RS04925 - 1060072..1060299 (+) 228 WP_060558086.1 hypothetical protein -
  HNS37_RS04930 - 1060286..1060888 (+) 603 WP_060558085.1 MT-A70 family methyltransferase -
  HNS37_RS04935 - 1061324..1062481 (+) 1158 WP_060558083.1 site-specific integrase -
  HNS37_RS04945 folD 1062771..1063643 (+) 873 WP_060554830.1 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD -
  HNS37_RS04950 ybcJ 1063647..1063859 (+) 213 WP_060556405.1 ribosome-associated protein YbcJ -

Sequence

Protein


Download         Length: 176 a.a.        Molecular weight: 19540.05 Da        Isoelectric Point: 7.2416

>NTDB_id=446258 HNS37_RS04895 WP_060558092.1 1057920..1058450(+) (ssb) [Proteus mirabilis strain M3-1-17]
MASKGVNKCILIGHLGQDPEIRYMPSGGAVANLTLATSESWRDKQTGEMKEKTEWHRVCIFGKLAEIAGEYLRKGSQVYI
EGSLQTRKWQDQSGQDRYTTEVVVNIGGTMQMLGGNQAGSQKPQQNQGWGQPQAPKAPQQQPKQQTPQSEPPMDFDDDIP
FAPIGLPYPRHAIYVI

Nucleotide


Download         Length: 531 bp        

>NTDB_id=446258 HNS37_RS04895 WP_060558092.1 1057920..1058450(+) (ssb) [Proteus mirabilis strain M3-1-17]
ATGGCAAGTAAAGGCGTGAATAAATGTATTCTCATTGGTCACCTAGGGCAGGATCCAGAAATCCGCTATATGCCATCAGG
TGGCGCAGTCGCTAATCTCACACTAGCCACATCGGAATCGTGGCGTGATAAACAAACCGGTGAGATGAAAGAAAAAACCG
AGTGGCATCGAGTATGCATCTTCGGAAAATTAGCGGAAATTGCAGGTGAATATCTGAGAAAAGGAAGTCAGGTATATATC
GAGGGTTCTCTTCAAACTCGTAAATGGCAAGACCAAAGCGGACAAGACCGATACACAACGGAAGTGGTAGTTAATATCGG
CGGTACGATGCAGATGTTAGGCGGTAATCAGGCAGGAAGCCAGAAACCTCAGCAGAATCAAGGATGGGGTCAACCGCAAG
CACCGAAAGCACCGCAACAACAACCTAAACAACAAACACCACAAAGTGAACCTCCGATGGATTTCGATGACGACATCCCC
TTCGCTCCTATCGGACTCCCCTACCCACGCCACGCTATTTATGTGATTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-112)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

70.787

100

0.716
  ssb Glaesserella parasuis strain SC1401

52.198

100

0.54
  ssb Neisseria gonorrhoeae MS11

44.886

100

0.449
  ssb Neisseria meningitidis MC58

44.886

100

0.449