Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   HA035_RS14100 Genome accession   NZ_CP053353
Coordinates   2803314..2803784 (-) Length   156 a.a.
NCBI ID   WP_000934770.1    Uniprot ID   -
Organism   Staphylococcus aureus strain 16405     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2772715..2828864 2803314..2803784 within 0


Gene organization within MGE regions


Location: 2772715..2828864
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HA035_RS13885 (HA035_13885) scn 2772715..2773065 (-) 351 WP_000702263.1 complement inhibitor SCIN-A -
  HA035_RS13890 (HA035_13890) - 2773576..2773911 (-) 336 Protein_2702 SH3 domain-containing protein -
  HA035_RS13895 (HA035_13895) sak 2774562..2775053 (-) 492 WP_000920038.1 staphylokinase -
  HA035_RS13900 (HA035_13900) - 2775244..2775999 (-) 756 WP_000861038.1 CHAP domain-containing protein -
  HA035_RS13905 (HA035_13905) - 2776011..2776265 (-) 255 WP_000611512.1 phage holin -
  HA035_RS13910 (HA035_13910) - 2776317..2776424 (+) 108 WP_031762631.1 hypothetical protein -
  HA035_RS13915 (HA035_13915) pepG1 2776477..2776611 (-) 135 WP_000226108.1 type I toxin-antitoxin system toxin PepG1 -
  HA035_RS13920 (HA035_13920) sea 2776762..2777535 (-) 774 WP_000750412.1 staphylococcal enterotoxin type A -
  HA035_RS13925 (HA035_13925) - 2777908..2778282 (-) 375 WP_000340977.1 hypothetical protein -
  HA035_RS13930 (HA035_13930) - 2778338..2778625 (-) 288 WP_001262621.1 hypothetical protein -
  HA035_RS13935 (HA035_13935) - 2778671..2778823 (-) 153 WP_001000058.1 hypothetical protein -
  HA035_RS13940 (HA035_13940) - 2778816..2782598 (-) 3783 WP_031836433.1 phage tail spike protein -
  HA035_RS13945 (HA035_13945) - 2782614..2784098 (-) 1485 WP_000567408.1 phage tail domain-containing protein -
  HA035_RS13950 (HA035_13950) - 2784095..2788624 (-) 4530 WP_031836434.1 phage tail tape measure protein -
  HA035_RS13955 - 2788681..2788818 (-) 138 WP_001549167.1 hypothetical protein -
  HA035_RS13960 (HA035_13955) - 2788869..2789219 (-) 351 WP_001096355.1 hypothetical protein -
  HA035_RS13965 (HA035_13960) - 2789269..2789499 (-) 231 Protein_2717 Ig-like domain-containing protein -
  HA035_RS13970 (HA035_13965) - 2789535..2790179 (-) 645 WP_000268741.1 major tail protein -
  HA035_RS13975 (HA035_13970) - 2790180..2790587 (-) 408 WP_000565498.1 hypothetical protein -
  HA035_RS13980 (HA035_13975) - 2790584..2790988 (-) 405 WP_000114225.1 HK97 gp10 family phage protein -
  HA035_RS13985 (HA035_13980) - 2790985..2791347 (-) 363 WP_000755150.1 head-tail adaptor protein -
  HA035_RS13990 (HA035_13985) - 2791331..2791615 (-) 285 WP_000150936.1 phage head-tail adapter protein -
  HA035_RS13995 (HA035_13990) - 2791605..2791889 (-) 285 WP_000238236.1 hypothetical protein -
  HA035_RS14000 (HA035_13995) - 2791909..2793054 (-) 1146 WP_000154555.1 phage major capsid protein -
  HA035_RS14005 (HA035_14000) - 2793078..2793815 (-) 738 WP_000861914.1 head maturation protease, ClpP-related -
  HA035_RS14010 (HA035_14005) - 2793799..2794986 (-) 1188 WP_000025274.1 phage portal protein -
  HA035_RS14015 (HA035_14010) - 2795002..2796663 (-) 1662 WP_000625088.1 terminase large subunit -
  HA035_RS14020 (HA035_14015) - 2796660..2797004 (-) 345 WP_000402904.1 hypothetical protein -
  HA035_RS14025 (HA035_14020) - 2797134..2797433 (-) 300 WP_000988336.1 HNH endonuclease -
  HA035_RS14030 (HA035_14025) - 2797665..2798081 (-) 417 WP_000590126.1 hypothetical protein -
  HA035_RS14035 (HA035_14030) - 2798109..2798309 (-) 201 WP_000265039.1 DUF1514 family protein -
  HA035_RS14040 (HA035_14035) - 2798309..2798458 (-) 150 WP_000595265.1 transcriptional activator RinB -
  HA035_RS14045 (HA035_14040) - 2798455..2798661 (-) 207 WP_000195820.1 DUF1381 domain-containing protein -
  HA035_RS14050 (HA035_14045) - 2798698..2799234 (-) 537 WP_001066444.1 dUTPase -
  HA035_RS14055 - 2799590..2799715 (-) 126 Protein_2735 DUF1024 family protein -
  HA035_RS14060 (HA035_14055) - 2799708..2800118 (-) 411 WP_000197968.1 hypothetical protein -
  HA035_RS14065 (HA035_14060) - 2800115..2800624 (-) 510 WP_001105598.1 hypothetical protein -
  HA035_RS14070 (HA035_14065) - 2800621..2801070 (-) 450 WP_000982711.1 YopX family protein -
  HA035_RS14075 (HA035_14070) - 2801135..2801377 (-) 243 WP_000131366.1 SAV1978 family virulence-associated passenger protein -
  HA035_RS14080 (HA035_14075) - 2801381..2801749 (-) 369 WP_000101274.1 SA1788 family PVL leukocidin-associated protein -
  HA035_RS14085 (HA035_14080) - 2801762..2802166 (-) 405 WP_000401964.1 RusA family crossover junction endodeoxyribonuclease -
  HA035_RS14090 (HA035_14085) - 2802175..2802393 (-) 219 WP_000338528.1 hypothetical protein -
  HA035_RS14095 (HA035_14090) - 2802400..2803284 (-) 885 WP_000148301.1 DnaD domain protein -
  HA035_RS14100 (HA035_14095) ssbA 2803314..2803784 (-) 471 WP_000934770.1 single-stranded DNA-binding protein Machinery gene
  HA035_RS14105 (HA035_14100) - 2803785..2804402 (-) 618 WP_235686151.1 MBL fold metallo-hydrolase -
  HA035_RS14110 (HA035_14105) - 2804483..2805403 (-) 921 WP_000138481.1 recombinase RecT -
  HA035_RS14115 (HA035_14110) - 2805405..2807348 (-) 1944 WP_000700565.1 AAA family ATPase -
  HA035_RS14120 (HA035_14115) - 2807357..2807620 (-) 264 WP_001205732.1 hypothetical protein -
  HA035_RS14125 (HA035_14120) - 2807629..2807889 (-) 261 WP_000291489.1 DUF1108 family protein -
  HA035_RS14130 (HA035_14125) - 2807982..2808143 (-) 162 WP_000066020.1 DUF1270 domain-containing protein -
  HA035_RS14135 (HA035_14130) - 2808140..2808460 (-) 321 WP_001120197.1 DUF771 domain-containing protein -
  HA035_RS14140 (HA035_14135) - 2808519..2809151 (+) 633 WP_000275058.1 hypothetical protein -
  HA035_RS14145 (HA035_14140) - 2809166..2809306 (-) 141 WP_000939496.1 hypothetical protein -
  HA035_RS14150 (HA035_14145) - 2809337..2809534 (-) 198 WP_001148861.1 hypothetical protein -
  HA035_RS14155 (HA035_14150) - 2809550..2810299 (-) 750 WP_001148337.1 phage antirepressor KilAC domain-containing protein -
  HA035_RS14160 (HA035_14155) - 2810356..2810895 (+) 540 WP_000351243.1 hypothetical protein -
  HA035_RS14165 (HA035_14160) - 2810919..2811179 (-) 261 WP_000435341.1 transcriptional regulator -
  HA035_RS14170 (HA035_14165) - 2811197..2811421 (-) 225 WP_000338186.1 DUF739 family protein -
  HA035_RS14175 (HA035_14170) - 2811580..2812350 (+) 771 WP_031783378.1 S24 family peptidase -
  HA035_RS14180 (HA035_14175) - 2812550..2812732 (+) 183 WP_000705240.1 hypothetical protein -
  HA035_RS14185 (HA035_14180) - 2812768..2812914 (+) 147 WP_001013104.1 hypothetical protein -
  HA035_RS14190 (HA035_14185) - 2812911..2813525 (-) 615 WP_000191459.1 hypothetical protein -
  HA035_RS14195 (HA035_14190) - 2813633..2814670 (+) 1038 WP_000857176.1 site-specific integrase -
  HA035_RS14200 (HA035_14195) sph 2814721..2815551 (+) 831 Protein_2764 sphingomyelin phosphodiesterase -
  HA035_RS14205 (HA035_14200) lukG 2815789..2816805 (-) 1017 WP_000595324.1 bi-component leukocidin LukGH subunit G -
  HA035_RS14210 (HA035_14205) lukH 2816827..2817882 (-) 1056 WP_000791407.1 bi-component leukocidin LukGH subunit H -
  HA035_RS14215 (HA035_14210) - 2818317..2819540 (+) 1224 WP_000206638.1 ArgE/DapE family deacylase -
  HA035_RS14220 (HA035_14215) - 2819912..2820757 (-) 846 WP_000812008.1 class I SAM-dependent methyltransferase -
  HA035_RS14225 (HA035_14220) - 2820819..2821730 (-) 912 WP_000825510.1 iron-hydroxamate ABC transporter substrate-binding protein -
  HA035_RS14230 (HA035_14225) - 2821891..2823198 (+) 1308 WP_001045079.1 TrkH family potassium uptake protein -
  HA035_RS14235 (HA035_14230) - 2824051..2824494 (-) 444 WP_000022887.1 GNAT family N-acetyltransferase -
  HA035_RS14240 (HA035_14235) - 2824600..2825036 (-) 437 Protein_2772 hypothetical protein -
  HA035_RS14245 (HA035_14240) - 2825354..2825944 (-) 591 WP_031806879.1 terminase small subunit -
  HA035_RS14250 (HA035_14245) - 2825941..2826153 (-) 213 WP_000128898.1 hypothetical protein -
  HA035_RS14255 (HA035_14250) - 2826214..2826760 (+) 547 Protein_2775 site-specific integrase -
  HA035_RS14260 (HA035_14255) groL 2826855..2828471 (-) 1617 WP_000240645.1 chaperonin GroEL -
  HA035_RS14265 (HA035_14260) groES 2828580..2828864 (-) 285 WP_000917289.1 co-chaperone GroES -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17713.63 Da        Isoelectric Point: 5.2672

>NTDB_id=444265 HA035_RS14100 WP_000934770.1 2803314..2803784(-) (ssbA) [Staphylococcus aureus strain 16405]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=444265 HA035_RS14100 WP_000934770.1 2803314..2803784(-) (ssbA) [Staphylococcus aureus strain 16405]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365