NTDB

Overview

Name	clpP	Type	Regulator
Locus tag	HIR77_RS19300	Genome accession	NZ_CP053102
Coordinates	3646701..3647294 (+)	Length	197 a.a.
NCBI ID	WP_003228214.1	Uniprot ID	A0A199WEF2
Organism	Bacillus subtilis subsp. subtilis str. 168
Function	degradation of ComK; degradation of DegU (predicted from homology) Competence regulation

Genomic Context

Location: 3641701..3652294

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HIR77_RS19270 (HIR77_19305)	psmA	3641955..3642290 (+)	336	WP_003242480.1	SMR family transporter	-
HIR77_RS19275 (HIR77_19310)	psmB	3642290..3642610 (+)	321	WP_003228222.1	QacE family quaternary ammonium compound efflux SMR transporter	-
HIR77_RS19280 (HIR77_19315)	yvdQ	3642646..3643158 (-)	513	WP_003243249.1	DUF3231 family protein	-
HIR77_RS19285 (HIR77_19320)	cotNP	3643410..3644753 (-)	1344	WP_003228217.1	FAD-binding oxidoreductase	-
HIR77_RS19290 (HIR77_19325)	cotR	3645109..3646071 (+)	963	WP_003243674.1	sporulation hydrolase CotR	-
HIR77_RS19300 (HIR77_19335)	clpP	3646701..3647294 (+)	594	WP_003228214.1	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	Regulator
HIR77_RS19305 (HIR77_19340)	pgmB	3647340..3648020 (-)	681	WP_003228210.1	beta-phosphoglucomutase	-
HIR77_RS19310 (HIR77_19345)	malL	3648017..3649702 (-)	1686	WP_003243333.1	oligo-1,6-glucosidase	-
HIR77_RS19315 (HIR77_19350)	mdxK	3649695..3651968 (-)	2274	WP_003243769.1	maltose phosphorylase	-

Sequence

Protein

Download Length: 197 a.a. Molecular weight: 21682.00 Da Isoelectric Point: 4.9416

                                >NTDB_id=443129 HIR77_RS19300 WP_003228214.1 3646701..3647294(+) (clpP) [Bacillus subtilis subsp. subtilis str. 168]

MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDT

MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQ

PLEVIERDTDRDNFKSAEEALEYGLIDKILTHTEDKK

Nucleotide

Download Length: 594 bp

                                >NTDB_id=443129 HIR77_RS19300 WP_003228214.1 3646701..3647294(+) (clpP) [Bacillus subtilis subsp. subtilis str. 168]

ATGAATTTAATACCTACAGTCATTGAACAAACGAACCGCGGGGAAAGAGCGTATGACATTTATTCTCGTCTATTAAAGGA

TCGTATCATCATGCTTGGATCTGCGATTGATGACAACGTTGCGAACTCCATCGTGTCACAGCTTTTATTCTTAGCAGCAG

AAGACCCTGAAAAAGAAATTTCTCTTTACATCAACAGCCCGGGCGGCTCTATTACAGCCGGTATGGCGATCTATGATACC

ATGCAGTTTATTAAGCCGAAGGTATCTACAATTTGTATCGGTATGGCTGCGTCAATGGGCGCGTTCCTGCTTGCAGCCGG

CGAAAAAGGCAAACGCTATGCGCTTCCAAACAGTGAAGTCATGATTCACCAGCCTCTTGGCGGTGCGCAAGGTCAAGCGA

CAGAAATTGAAATTGCTGCGAAACGCATTCTCTTGCTTCGCGACAAATTAAACAAAGTCCTAGCTGAACGTACTGGCCAG

CCGCTTGAAGTGATCGAACGCGACACAGACCGTGATAACTTCAAGTCTGCTGAAGAAGCGCTTGAATACGGCCTGATTGA

CAAAATTTTGACTCACACAGAAGACAAAAAGTAA

Domains

Predicted by InterproScan.

Clp protease (CLP_protease)

(13-192)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A199WEF2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
clpP	Bacillus subtilis subsp. subtilis str. 168	100	100	1
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	68.617	95.431	0.655
clpP	Streptococcus thermophilus LMG 18311	58.163	99.492	0.579
clpP	Streptococcus thermophilus LMD-9	58.163	99.492	0.579
clpP	Streptococcus pneumoniae D39	57.812	97.462	0.563
clpP	Streptococcus pneumoniae Rx1	57.812	97.462	0.563
clpP	Streptococcus pneumoniae R6	57.812	97.462	0.563
clpP	Streptococcus pneumoniae TIGR4	57.812	97.462	0.563
clpP	Lactococcus lactis subsp. cremoris KW2	57.895	96.447	0.558
clpP	Streptococcus pyogenes JRS4	56.122	99.492	0.558
clpP	Streptococcus pyogenes MGAS315	56.122	99.492	0.558
clpP	Streptococcus mutans UA159	54.822	100	0.548
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	55.789	96.447	0.538

Detailed information NTG0443129