Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   HIR77_RS17895 Genome accession   NZ_CP053102
Coordinates   3370107..3370247 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3365107..3375247
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HIR77_RS17870 (HIR77_17905) yuxO 3365420..3365800 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  HIR77_RS17875 (HIR77_17910) comA 3365819..3366463 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  HIR77_RS17880 (HIR77_17915) comP 3366544..3368853 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  HIR77_RS17885 (HIR77_17920) comX 3368868..3369035 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  HIR77_RS17890 (HIR77_17925) comQ 3369023..3369922 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  HIR77_RS17895 (HIR77_17930) degQ 3370107..3370247 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  HIR77_RS17900 (HIR77_17935) - 3370469..3370594 (+) 126 WP_003228793.1 hypothetical protein -
  HIR77_RS17905 (HIR77_17940) - 3370708..3371076 (+) 369 WP_003243784.1 hypothetical protein -
  HIR77_RS17910 (HIR77_17945) pdeH 3371052..3372281 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  HIR77_RS17915 (HIR77_17950) pncB 3372418..3373890 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  HIR77_RS17920 (HIR77_17955) pncA 3373906..3374457 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  HIR77_RS17925 (HIR77_17960) yueI 3374554..3374952 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=443127 HIR77_RS17895 WP_003220708.1 3370107..3370247(-) (degQ) [Bacillus subtilis subsp. subtilis str. 168]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=443127 HIR77_RS17895 WP_003220708.1 3370107..3370247(-) (degQ) [Bacillus subtilis subsp. subtilis str. 168]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1