Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   HKW69_RS17015 Genome accession   NZ_CP053080
Coordinates   3530542..3531048 (+) Length   168 a.a.
NCBI ID   WP_000098523.1    Uniprot ID   -
Organism   Escherichia coli strain HB37     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3495711..3537365 3530542..3531048 within 0


Gene organization within MGE regions


Location: 3495711..3537365
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HKW69_RS27655 - 3495711..3498362 (-) 2652 WP_284729714.1 phage tailspike protein -
  HKW69_RS16775 (HKW69_16790) - 3498467..3499195 (-) 729 WP_170171992.1 hypothetical protein -
  HKW69_RS16780 (HKW69_16795) - 3499284..3499910 (-) 627 WP_024189440.1 P22AR C-terminal domain-containing protein -
  HKW69_RS16785 (HKW69_16800) - 3499984..3500157 (-) 174 WP_021518013.1 hypothetical protein -
  HKW69_RS16790 (HKW69_16805) - 3500257..3500898 (+) 642 WP_001008290.1 LexA family transcriptional regulator -
  HKW69_RS16795 (HKW69_16810) - 3500959..3501279 (+) 321 WP_000275950.1 hypothetical protein -
  HKW69_RS16800 (HKW69_16815) - 3501288..3503291 (-) 2004 WP_170172027.1 injection protein -
  HKW69_RS16805 (HKW69_16820) - 3503291..3504667 (-) 1377 WP_170171993.1 phage DNA ejection protein -
  HKW69_RS16810 (HKW69_16825) - 3504667..3505329 (-) 663 WP_244587348.1 DNA transfer protein -
  HKW69_RS16815 (HKW69_16830) - 3505313..3505702 (-) 390 WP_170171917.1 hypothetical protein -
  HKW69_RS16820 (HKW69_16835) - 3505699..3506547 (-) 849 WP_170171994.1 tail needle knob protein -
  HKW69_RS16825 (HKW69_16840) - 3506547..3507965 (-) 1419 WP_102812485.1 packaged DNA stabilization protein gp10 -
  HKW69_RS16830 (HKW69_16845) - 3507975..3508436 (-) 462 WP_001140510.1 packaged DNA stabilization gp4 family protein -
  HKW69_RS16835 (HKW69_16850) - 3508417..3508605 (-) 189 WP_001462613.1 hypothetical protein -
  HKW69_RS16840 (HKW69_16855) - 3508647..3509900 (-) 1254 WP_000013264.1 P22 phage major capsid protein family protein -
  HKW69_RS16845 (HKW69_16860) - 3509919..3510812 (-) 894 WP_170171995.1 scaffolding protein -
  HKW69_RS16850 (HKW69_16865) - 3510903..3513101 (-) 2199 WP_170171996.1 portal protein -
  HKW69_RS16855 (HKW69_16870) - 3513103..3514518 (-) 1416 WP_000200779.1 PBSX family phage terminase large subunit -
  HKW69_RS16860 (HKW69_16875) - 3514515..3514955 (-) 441 WP_000113732.1 hypothetical protein -
  HKW69_RS16865 (HKW69_16880) - 3514958..3515200 (-) 243 WP_170171997.1 DUF2560 family protein -
  HKW69_RS16870 (HKW69_16885) - 3515504..3515983 (-) 480 WP_000191869.1 DUF2829 domain-containing protein -
  HKW69_RS16875 (HKW69_16890) - 3516065..3516217 (-) 153 WP_001543881.1 hypothetical protein -
  HKW69_RS16880 (HKW69_16895) - 3516205..3516672 (-) 468 WP_170171998.1 lysis protein -
  HKW69_RS16885 (HKW69_16900) - 3516669..3517145 (-) 477 WP_080200637.1 glycoside hydrolase family protein -
  HKW69_RS16890 (HKW69_16905) - 3517129..3517452 (-) 324 WP_000783734.1 phage holin, lambda family -
  HKW69_RS16895 (HKW69_16910) - 3518129..3518752 (-) 624 WP_089622057.1 antitermination protein -
  HKW69_RS16900 (HKW69_16915) - 3518749..3519412 (-) 664 Protein_3368 serine/threonine protein phosphatase -
  HKW69_RS16905 (HKW69_16920) - 3519390..3519596 (-) 207 WP_089622058.1 phage NinH family protein -
  HKW69_RS16910 (HKW69_16925) - 3519593..3520204 (-) 612 WP_001108037.1 recombination protein NinG -
  HKW69_RS16915 (HKW69_16930) - 3520197..3520406 (-) 210 WP_001543885.1 protein NinF -
  HKW69_RS16920 (HKW69_16935) - 3520366..3520767 (-) 402 WP_170171999.1 hypothetical protein -
  HKW69_RS16925 (HKW69_16940) - 3520770..3520946 (-) 177 WP_025748955.1 NinE family protein -
  HKW69_RS16930 (HKW69_16945) - 3520943..3521353 (-) 411 WP_000814617.1 recombination protein NinB -
  HKW69_RS16935 (HKW69_16950) - 3521361..3521567 (-) 207 WP_023351780.1 hypothetical protein -
  HKW69_RS16940 (HKW69_16955) - 3521644..3523524 (-) 1881 WP_078233029.1 toprim domain-containing protein -
  HKW69_RS16945 (HKW69_16960) - 3523632..3524492 (-) 861 WP_000067065.1 replication protein -
  HKW69_RS16950 (HKW69_16965) - 3524485..3524631 (-) 147 WP_000166207.1 DUF2740 family protein -
  HKW69_RS16955 (HKW69_16970) - 3524664..3524960 (-) 297 WP_000189606.1 CII family transcriptional regulator -
  HKW69_RS16960 (HKW69_16975) - 3525098..3525298 (-) 201 WP_000437871.1 Cro/CI family transcriptional regulator -
  HKW69_RS16965 (HKW69_16980) - 3525399..3526112 (+) 714 WP_021568302.1 LexA family transcriptional regulator -
  HKW69_RS16970 (HKW69_16985) - 3526120..3526557 (+) 438 WP_000588959.1 hypothetical protein -
  HKW69_RS16975 (HKW69_16990) - 3526544..3526915 (+) 372 WP_000050904.1 hypothetical protein -
  HKW69_RS27430 - 3527685..3527753 (+) 69 Protein_3384 antitermination protein -
  HKW69_RS16985 (HKW69_17000) - 3527756..3528118 (+) 363 WP_170172000.1 antitermination N domain protein -
  HKW69_RS16990 (HKW69_17005) - 3528149..3528643 (-) 495 WP_000382838.1 hypothetical protein -
  HKW69_RS16995 (HKW69_17010) - 3528945..3529115 (+) 171 WP_001183771.1 hypothetical protein -
  HKW69_RS17000 (HKW69_17015) - 3529191..3529361 (+) 171 WP_170171918.1 hypothetical protein -
  HKW69_RS17005 (HKW69_17020) - 3529370..3530077 (+) 708 WP_021556101.1 Rad52/Rad22 family DNA repair protein -
  HKW69_RS17010 (HKW69_17025) - 3530078..3530545 (+) 468 WP_000018646.1 HNH endonuclease -
  HKW69_RS17015 (HKW69_17030) ssb 3530542..3531048 (+) 507 WP_000098523.1 single-stranded DNA-binding protein Machinery gene
  HKW69_RS17020 (HKW69_17035) - 3531062..3531355 (+) 294 WP_001111278.1 phage anti-RecBCD protein -
  HKW69_RS17025 (HKW69_17040) - 3531366..3531530 (+) 165 WP_001214456.1 DUF2737 family protein -
  HKW69_RS17030 (HKW69_17045) - 3531527..3532069 (+) 543 WP_170172028.1 ead/Ea22-like family protein -
  HKW69_RS17035 (HKW69_17050) - 3532066..3532950 (+) 885 WP_048955281.1 ead/Ea22-like family protein -
  HKW69_RS17040 (HKW69_17055) - 3532952..3533239 (+) 288 WP_000212745.1 hypothetical protein -
  HKW69_RS27435 - 3533243..3533371 (+) 129 Protein_3397 DUF550 domain-containing protein -
  HKW69_RS17045 (HKW69_17060) - 3533423..3533881 (+) 459 WP_250881141.1 dATP/dGTP pyrophosphohydrolase domain-containing protein -
  HKW69_RS26935 - 3533874..3534158 (+) 285 WP_205901010.1 ASCH domain-containing protein -
  HKW69_RS17050 (HKW69_17065) - 3534231..3534575 (+) 345 WP_001281200.1 hypothetical protein -
  HKW69_RS17055 (HKW69_17070) - 3534681..3534899 (+) 219 WP_001303849.1 excisionase -
  HKW69_RS17060 (HKW69_17075) - 3534877..3535947 (+) 1071 WP_000533643.1 tyrosine-type recombinase/integrase -
  HKW69_RS17065 (HKW69_17080) ybhC 3536082..3537365 (+) 1284 WP_001091600.1 putative acyl-CoA thioester hydrolase -

Sequence

Protein


Download         Length: 168 a.a.        Molecular weight: 18761.06 Da        Isoelectric Point: 8.4877

>NTDB_id=442890 HKW69_RS17015 WP_000098523.1 3530542..3531048(+) (ssb) [Escherichia coli strain HB37]
MSSRGINKVIILGRVGQDPEVRYSPSGTAFANLTIATSEQWRDKNTGEQKELTEWHRVAVSGKLAEVVGQYVKKGDQIYF
EGMLRTRKWKDQSGQDRYTTEVHVGINGVMQMLGGIGDSKQQAASRQSQKPQQQSSPAQHNEPPMDFDDDIPFAPVTLPF
PRHAIHAI

Nucleotide


Download         Length: 507 bp        

>NTDB_id=442890 HKW69_RS17015 WP_000098523.1 3530542..3531048(+) (ssb) [Escherichia coli strain HB37]
ATGAGTTCTCGCGGGATAAATAAGGTGATAATCCTTGGTCGGGTAGGACAAGACCCGGAAGTTCGATACTCACCATCAGG
AACAGCGTTCGCTAACCTGACAATAGCCACATCAGAACAATGGCGAGATAAAAATACTGGCGAGCAAAAGGAATTGACTG
AATGGCATCGTGTTGCTGTATCCGGGAAACTGGCTGAGGTCGTGGGGCAGTATGTGAAAAAAGGTGATCAGATTTATTTC
GAGGGAATGCTGAGAACCAGAAAGTGGAAAGACCAGTCAGGGCAAGACCGTTACACAACCGAGGTTCATGTCGGAATTAA
TGGCGTGATGCAAATGCTTGGCGGCATTGGCGACAGCAAACAACAAGCAGCCAGCAGGCAATCACAGAAGCCACAGCAGC
AATCATCACCAGCACAACACAACGAACCTCCGATGGATTTTGACGACGATATACCCTTTGCACCAGTAACTCTCCCCTTC
CCTCGTCACGCTATTCACGCTATTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-105)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

61.017

100

0.643
  ssb Glaesserella parasuis strain SC1401

45.304

100

0.488
  ssb Neisseria meningitidis MC58

38.636

100

0.405
  ssb Neisseria gonorrhoeae MS11

38.636

100

0.405