Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PMCN06_RS10245 | Genome accession | NC_017027 |
| Coordinates | 2179394..2179843 (-) | Length | 149 a.a. |
| NCBI ID | WP_015691052.1 | Uniprot ID | - |
| Organism | Pasteurella multocida subsp. multocida str. HN06 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2165134..2228723 | 2179394..2179843 | within | 0 |
Gene organization within MGE regions
Location: 2165134..2228723
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PMCN06_RS10150 (PMCN06_2044) | metN | 2165134..2166168 (-) | 1035 | WP_005718783.1 | methionine ABC transporter ATP-binding protein MetN | - |
| PMCN06_RS10155 (PMCN06_2045) | gmhB | 2166361..2166915 (+) | 555 | WP_014668555.1 | D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase | - |
| PMCN06_RS10200 (PMCN06_2047) | - | 2173001..2174053 (-) | 1053 | WP_250010829.1 | tyrosine-type recombinase/integrase | - |
| PMCN06_RS11620 (PMCN06_2048) | - | 2173963..2174295 (-) | 333 | WP_015691045.1 | helix-turn-helix domain-containing protein | - |
| PMCN06_RS10205 (PMCN06_2049) | - | 2174423..2174893 (-) | 471 | WP_015691046.1 | hypothetical protein | - |
| PMCN06_RS10210 (PMCN06_2050) | - | 2174897..2175193 (-) | 297 | WP_015691047.1 | hypothetical protein | - |
| PMCN06_RS10215 (PMCN06_2051) | - | 2175249..2175971 (-) | 723 | WP_014391442.1 | phage antirepressor KilAC domain-containing protein | - |
| PMCN06_RS10220 (PMCN06_2052) | - | 2175982..2176203 (-) | 222 | WP_014391443.1 | hypothetical protein | - |
| PMCN06_RS10225 (PMCN06_2053) | - | 2176448..2177356 (-) | 909 | WP_015691048.1 | P63C domain-containing protein | - |
| PMCN06_RS10230 (PMCN06_2054) | - | 2177460..2177816 (-) | 357 | WP_015691049.1 | hypothetical protein | - |
| PMCN06_RS10235 (PMCN06_2055) | - | 2177825..2178313 (-) | 489 | WP_015691050.1 | DUF551 domain-containing protein | - |
| PMCN06_RS10240 (PMCN06_2056) | rdgC | 2178354..2179256 (-) | 903 | WP_015691051.1 | recombination-associated protein RdgC | - |
| PMCN06_RS10245 (PMCN06_2057) | ssb | 2179394..2179843 (-) | 450 | WP_015691052.1 | single-stranded DNA-binding protein | Machinery gene |
| PMCN06_RS10250 (PMCN06_2058) | - | 2179843..2180502 (-) | 660 | WP_041423209.1 | translocation protein TolB precursor | - |
| PMCN06_RS10255 (PMCN06_2059) | - | 2180489..2181442 (-) | 954 | WP_014391451.1 | recombinase RecT | - |
| PMCN06_RS10260 (PMCN06_2060) | - | 2181444..2181731 (-) | 288 | WP_014391452.1 | hypothetical protein | - |
| PMCN06_RS10265 | - | 2181744..2181980 (-) | 237 | WP_041423119.1 | hypothetical protein | - |
| PMCN06_RS10270 (PMCN06_2061) | - | 2181952..2182251 (-) | 300 | WP_014391453.1 | hypothetical protein | - |
| PMCN06_RS10275 (PMCN06_2062) | - | 2182399..2182629 (+) | 231 | WP_223251317.1 | hypothetical protein | - |
| PMCN06_RS10280 (PMCN06_2064) | - | 2182738..2183562 (-) | 825 | WP_015691055.1 | NYN domain-containing protein | - |
| PMCN06_RS10285 (PMCN06_2065) | - | 2183901..2184128 (-) | 228 | WP_014390715.1 | hypothetical protein | - |
| PMCN06_RS10290 (PMCN06_2066) | - | 2184632..2185156 (-) | 525 | WP_041423181.1 | DUF2730 family protein | - |
| PMCN06_RS10295 (PMCN06_2067) | - | 2185128..2185523 (-) | 396 | WP_014391463.1 | hypothetical protein | - |
| PMCN06_RS10300 (PMCN06_2068) | - | 2185573..2186259 (-) | 687 | WP_014391464.1 | XRE family transcriptional regulator | - |
| PMCN06_RS10305 (PMCN06_2069) | - | 2186387..2186596 (+) | 210 | WP_014391465.1 | helix-turn-helix transcriptional regulator | - |
| PMCN06_RS10310 (PMCN06_2070) | - | 2186645..2187097 (+) | 453 | WP_014391466.1 | phage regulatory CII family protein | - |
| PMCN06_RS10315 (PMCN06_2071) | - | 2187155..2187335 (+) | 181 | Protein_2022 | hypothetical protein | - |
| PMCN06_RS10320 (PMCN06_2072) | - | 2187500..2188318 (+) | 819 | WP_015691057.1 | hypothetical protein | - |
| PMCN06_RS10325 (PMCN06_2073) | - | 2188315..2189679 (+) | 1365 | WP_015691058.1 | replicative DNA helicase | - |
| PMCN06_RS10330 (PMCN06_2074) | - | 2189733..2190044 (+) | 312 | Protein_2025 | MT-A70 family methyltransferase | - |
| PMCN06_RS10335 (PMCN06_2075) | - | 2190054..2190404 (+) | 351 | WP_015691060.1 | hypothetical protein | - |
| PMCN06_RS10340 (PMCN06_2076) | - | 2190426..2190932 (+) | 507 | WP_015691061.1 | DUF1367 family protein | - |
| PMCN06_RS10345 (PMCN06_2077) | - | 2191017..2191667 (+) | 651 | WP_015691062.1 | metallophosphoesterase | - |
| PMCN06_RS10350 (PMCN06_2078) | - | 2191741..2191953 (+) | 213 | WP_015691063.1 | hypothetical protein | - |
| PMCN06_RS10355 (PMCN06_2079) | - | 2192041..2192643 (+) | 603 | WP_015691064.1 | recombination protein NinG | - |
| PMCN06_RS10360 (PMCN06_2080) | - | 2192643..2193008 (+) | 366 | WP_015691065.1 | antiterminator Q family protein | - |
| PMCN06_RS10370 (PMCN06_2083) | - | 2193810..2194106 (+) | 297 | WP_014390733.1 | hypothetical protein | - |
| PMCN06_RS10375 (PMCN06_2084) | - | 2194103..2194633 (+) | 531 | WP_041423051.1 | lysozyme | - |
| PMCN06_RS11625 | - | 2194606..2194929 (+) | 324 | WP_014667795.1 | DUF2570 family protein | - |
| PMCN06_RS10385 (PMCN06_2086) | - | 2195151..2195585 (-) | 435 | WP_014390736.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| PMCN06_RS11630 | - | 2195614..2195796 (-) | 183 | WP_016533497.1 | type II toxin-antitoxin system HicA family toxin | - |
| PMCN06_RS10390 (PMCN06_2087) | - | 2195879..2196376 (+) | 498 | WP_014390737.1 | terminase | - |
| PMCN06_RS10395 (PMCN06_2088) | - | 2196360..2197595 (+) | 1236 | WP_015691067.1 | PBSX family phage terminase large subunit | - |
| PMCN06_RS10400 (PMCN06_2089) | - | 2197605..2199008 (+) | 1404 | WP_015691068.1 | DUF4055 domain-containing protein | - |
| PMCN06_RS10405 (PMCN06_2090) | - | 2198986..2200599 (+) | 1614 | WP_228376242.1 | minor capsid protein | - |
| PMCN06_RS10410 (PMCN06_2091) | - | 2200602..2200820 (+) | 219 | WP_015691070.1 | hypothetical protein | - |
| PMCN06_RS10415 (PMCN06_2092) | - | 2200795..2201229 (+) | 435 | WP_015691071.1 | HD domain-containing protein | - |
| PMCN06_RS11780 (PMCN06_2093) | - | 2201269..2201436 (+) | 168 | WP_015691072.1 | hypothetical protein | - |
| PMCN06_RS10420 (PMCN06_2094) | - | 2201565..2202335 (+) | 771 | WP_015691073.1 | hypothetical protein | - |
| PMCN06_RS10425 (PMCN06_2095) | - | 2202353..2203510 (+) | 1158 | WP_015691074.1 | P22 phage major capsid protein family protein | - |
| PMCN06_RS10430 (PMCN06_2096) | - | 2203567..2203803 (+) | 237 | WP_015691075.1 | HeH/LEM domain-containing protein | - |
| PMCN06_RS10435 (PMCN06_2097) | - | 2203820..2204287 (+) | 468 | WP_015691076.1 | DnaT-like ssDNA-binding protein | - |
| PMCN06_RS10440 (PMCN06_2098) | - | 2204289..2204663 (+) | 375 | WP_015691077.1 | hypothetical protein | - |
| PMCN06_RS10445 (PMCN06_2099) | - | 2204665..2205066 (+) | 402 | WP_015691078.1 | HK97 gp10 family phage protein | - |
| PMCN06_RS10450 (PMCN06_2100) | - | 2205066..2205458 (+) | 393 | WP_015691079.1 | phage tail terminator-like protein | - |
| PMCN06_RS10455 (PMCN06_2101) | - | 2205471..2206487 (+) | 1017 | WP_015691080.1 | phage tail tube protein | - |
| PMCN06_RS10460 (PMCN06_2102) | - | 2206561..2206965 (+) | 405 | WP_005756587.1 | hypothetical protein | - |
| PMCN06_RS10465 (PMCN06_2103) | - | 2206974..2207303 (+) | 330 | WP_015691081.1 | hypothetical protein | - |
| PMCN06_RS10470 (PMCN06_2104) | - | 2207311..2207637 (+) | 327 | WP_015691082.1 | phage tail protein | - |
| PMCN06_RS10475 (PMCN06_2105) | - | 2207655..2210903 (+) | 3249 | WP_015691083.1 | tape measure protein | - |
| PMCN06_RS10480 (PMCN06_2106) | - | 2210900..2211604 (+) | 705 | WP_015691084.1 | phage minor tail protein L | - |
| PMCN06_RS10485 (PMCN06_2107) | - | 2211607..2212347 (+) | 741 | WP_041423184.1 | C40 family peptidase | - |
| PMCN06_RS10490 (PMCN06_2108) | - | 2212290..2212910 (+) | 621 | WP_014667799.1 | tail assembly protein | - |
| PMCN06_RS10495 (PMCN06_2109) | - | 2212914..2217026 (+) | 4113 | WP_015691086.1 | phage tail protein | - |
| PMCN06_RS10500 (PMCN06_2110) | - | 2217074..2217397 (+) | 324 | WP_014390761.1 | hypothetical protein | - |
| PMCN06_RS11890 (PMCN06_2111) | - | 2217433..2217564 (-) | 132 | WP_015691087.1 | hypothetical protein | - |
| PMCN06_RS10505 (PMCN06_2112) | - | 2217567..2218121 (-) | 555 | WP_015691088.1 | toll/interleukin-1 receptor domain-containing protein | - |
| PMCN06_RS10510 (PMCN06_2113) | - | 2218132..2219817 (-) | 1686 | WP_041423185.1 | AlwI family type II restriction endonuclease | - |
| PMCN06_RS10515 (PMCN06_2114) | - | 2219831..2220682 (-) | 852 | WP_015691090.1 | DNA adenine methylase | - |
| PMCN06_RS10520 (PMCN06_2115) | - | 2220686..2220892 (-) | 207 | WP_015691091.1 | helix-turn-helix domain-containing protein | - |
| PMCN06_RS10525 (PMCN06_2116) | - | 2220979..2221386 (-) | 408 | WP_015691092.1 | DUF1870 family protein | - |
| PMCN06_RS10530 (PMCN06_2117) | - | 2221675..2223171 (+) | 1497 | WP_015691093.1 | DUF4041 domain-containing protein | - |
| PMCN06_RS10535 (PMCN06_2118) | toxA | 2223334..2227191 (+) | 3858 | WP_015691094.1 | dermonecrotic toxin ToxA | - |
| PMCN06_RS10540 (PMCN06_2119) | - | 2227905..2228723 (+) | 819 | WP_015691095.1 | phage antirepressor N-terminal domain-containing protein | - |
Sequence
Protein
Download Length: 149 a.a. Molecular weight: 17003.78 Da Isoelectric Point: 5.3193
>NTDB_id=44286 PMCN06_RS10245 WP_015691052.1 2179394..2179843(-) (ssb) [Pasteurella multocida subsp. multocida str. HN06]
MAGVNKAIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQPQQAQAPQNNAYANAKSGKPVQKFDNFEEDDIPF
MAGVNKAIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQPQQAQAPQNNAYANAKSGKPVQKFDNFEEDDIPF
Nucleotide
Download Length: 450 bp
>NTDB_id=44286 PMCN06_RS10245 WP_015691052.1 2179394..2179843(-) (ssb) [Pasteurella multocida subsp. multocida str. HN06]
ATGGCTGGAGTCAATAAAGCAATTATCGTGGGGAATTTGGGAAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGTGTCGCCACAAGCGAAAGTTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGCCAAGCTGAAGTAGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAAGGA
CGCCTAAAAACCCGTAAATGGCAAGACCAAAATGGGCAAGATCGCTACACTACCGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCACAACCGCAGCAAGCACAAGCACCGCAAAACAATGCTTATGCGAATGCGAAAAGTGGAA
AACCAGTGCAGAAGTTTGATAATTTTGAAGAAGACGATATACCGTTTTGA
ATGGCTGGAGTCAATAAAGCAATTATCGTGGGGAATTTGGGAAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGTGTCGCCACAAGCGAAAGTTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGCCAAGCTGAAGTAGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAAGGA
CGCCTAAAAACCCGTAAATGGCAAGACCAAAATGGGCAAGATCGCTACACTACCGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCACAACCGCAGCAAGCACAAGCACCGCAAAACAATGCTTATGCGAATGCGAAAAGTGGAA
AACCAGTGCAGAAGTTTGATAATTTTGAAGAAGACGATATACCGTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
66.298 |
100 |
0.805 |
| ssb | Vibrio cholerae strain A1552 |
49.721 |
100 |
0.597 |
| ssb | Neisseria gonorrhoeae MS11 |
45.985 |
91.946 |
0.423 |
| ssb | Neisseria meningitidis MC58 |
45.985 |
91.946 |
0.423 |