Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   PMCN06_RS00280 Genome accession   NC_017027
Coordinates   45035..45487 (-) Length   150 a.a.
NCBI ID   WP_014390703.1    Uniprot ID   -
Organism   Pasteurella multocida subsp. multocida str. HN06     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 39830..88814 45035..45487 within 0


Gene organization within MGE regions


Location: 39830..88814
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PMCN06_RS00240 (PMCN06_0043) - 39830..40867 (-) 1038 WP_016533424.1 tyrosine-type recombinase/integrase -
  PMCN06_RS11785 - 40876..41262 (-) 387 WP_016533425.1 hypothetical protein -
  PMCN06_RS00245 (PMCN06_0044) - 41378..41833 (-) 456 WP_014390696.1 hypothetical protein -
  PMCN06_RS00250 (PMCN06_0045) - 41878..42231 (-) 354 WP_014390697.1 hypothetical protein -
  PMCN06_RS00255 (PMCN06_0046) - 42240..42728 (-) 489 WP_014390698.1 DUF551 domain-containing protein -
  PMCN06_RS00260 (PMCN06_0047) rdgC 42769..43671 (-) 903 WP_014390699.1 recombination-associated protein RdgC -
  PMCN06_RS00265 (PMCN06_0048) - 43674..44057 (-) 384 WP_014390700.1 hypothetical protein -
  PMCN06_RS00270 (PMCN06_0049) - 44136..44447 (-) 312 WP_014390701.1 DUF6378 domain-containing protein -
  PMCN06_RS00275 (PMCN06_0050) - 44447..44968 (-) 522 WP_014390702.1 MazG-like family protein -
  PMCN06_RS00280 (PMCN06_0051) ssb 45035..45487 (-) 453 WP_014390703.1 single-stranded DNA-binding protein Machinery gene
  PMCN06_RS00285 (PMCN06_0052) - 45498..46199 (-) 702 WP_014390704.1 ERF family protein -
  PMCN06_RS00290 (PMCN06_0053) - 46242..46892 (-) 651 WP_014390705.1 ribonuclease H-like domain-containing protein -
  PMCN06_RS11715 (PMCN06_0055) - 47065..47226 (-) 162 WP_014390707.1 hypothetical protein -
  PMCN06_RS00295 (PMCN06_0056) - 47240..47476 (-) 237 WP_014390708.1 hypothetical protein -
  PMCN06_RS00300 (PMCN06_0057) - 47448..47747 (-) 300 WP_014390709.1 hypothetical protein -
  PMCN06_RS00305 (PMCN06_0058) - 47895..48125 (+) 231 WP_223251317.1 hypothetical protein -
  PMCN06_RS00310 (PMCN06_0059) - 48187..48843 (-) 657 WP_014390711.1 Bro-N domain-containing protein -
  PMCN06_RS00315 (PMCN06_0060) - 49128..49964 (-) 837 WP_014390712.1 KilA-N domain-containing protein -
  PMCN06_RS00320 (PMCN06_0061) - 50075..50452 (-) 378 WP_014390713.1 hypothetical protein -
  PMCN06_RS00325 (PMCN06_0062) - 50427..50618 (-) 192 WP_014390714.1 hypothetical protein -
  PMCN06_RS00330 (PMCN06_0063) - 51171..51398 (-) 228 WP_014390715.1 hypothetical protein -
  PMCN06_RS00335 (PMCN06_0064) - 51910..52734 (-) 825 WP_014390716.1 DUF3037 domain-containing protein -
  PMCN06_RS00340 (PMCN06_0065) - 52731..53468 (-) 738 WP_014390717.1 HipA family kinase -
  PMCN06_RS00345 (PMCN06_0066) - 53551..54228 (-) 678 WP_014390718.1 XRE family transcriptional regulator -
  PMCN06_RS00350 (PMCN06_0067) - 54352..54549 (+) 198 WP_014390719.1 helix-turn-helix domain-containing protein -
  PMCN06_RS00355 (PMCN06_0068) - 54599..55051 (+) 453 WP_014390720.1 phage regulatory CII family protein -
  PMCN06_RS00360 (PMCN06_0069) - 55103..55786 (+) 684 WP_014390721.1 phage antirepressor KilAC domain-containing protein -
  PMCN06_RS00365 (PMCN06_0070) - 55783..56136 (+) 354 WP_014390722.1 HNH endonuclease -
  PMCN06_RS00370 (PMCN06_0071) - 56138..57037 (+) 900 WP_014390723.1 hypothetical protein -
  PMCN06_RS00375 (PMCN06_0072) - 57037..57732 (+) 696 WP_014390724.1 replication protein P -
  PMCN06_RS00380 (PMCN06_0073) - 57725..58255 (+) 531 WP_014390725.1 MT-A70 family methyltransferase -
  PMCN06_RS00385 (PMCN06_0074) - 58264..58701 (+) 438 WP_014390726.1 DUF1367 family protein -
  PMCN06_RS00390 (PMCN06_0075) - 58861..59076 (+) 216 WP_014390727.1 hypothetical protein -
  PMCN06_RS00395 (PMCN06_0076) - 59069..59671 (+) 603 WP_014390728.1 recombination protein NinG -
  PMCN06_RS00400 (PMCN06_0077) - 59671..60036 (+) 366 WP_014390729.1 antiterminator Q family protein -
  PMCN06_RS00405 (PMCN06_0078) - 60112..60687 (+) 576 WP_014390730.1 hypothetical protein -
  PMCN06_RS00410 (PMCN06_0079) - 60975..61592 (+) 618 WP_014390731.1 KilA-N domain-containing protein -
  PMCN06_RS11790 - 61801..62016 (-) 216 WP_015691066.1 hypothetical protein -
  PMCN06_RS00420 (PMCN06_0081) - 62394..62690 (+) 297 WP_014390733.1 hypothetical protein -
  PMCN06_RS00425 (PMCN06_0082) - 62687..63217 (+) 531 WP_041423051.1 lysozyme -
  PMCN06_RS11490 - 63190..63513 (+) 324 WP_014667795.1 DUF2570 family protein -
  PMCN06_RS00435 (PMCN06_0084) - 63735..64169 (-) 435 WP_014390736.1 type II toxin-antitoxin system HicB family antitoxin -
  PMCN06_RS11495 - 64198..64380 (-) 183 WP_016533497.1 type II toxin-antitoxin system HicA family toxin -
  PMCN06_RS00440 (PMCN06_0085) - 64463..64960 (+) 498 WP_014390737.1 terminase -
  PMCN06_RS00445 (PMCN06_0086) - 64944..66170 (+) 1227 WP_014390738.1 PBSX family phage terminase large subunit -
  PMCN06_RS00450 (PMCN06_0087) - 66185..67630 (+) 1446 WP_014390739.1 anti-CBASS protein Acb1 family protein -
  PMCN06_RS00455 (PMCN06_0088) - 67584..68555 (+) 972 WP_014390740.1 phage minor head protein -
  PMCN06_RS00460 (PMCN06_0089) - 68570..69916 (+) 1347 WP_014390741.1 DUF2213 domain-containing protein -
  PMCN06_RS00465 (PMCN06_0090) - 69916..70350 (+) 435 WP_014390742.1 hypothetical protein -
  PMCN06_RS00470 (PMCN06_0091) - 70437..71360 (+) 924 WP_228376244.1 major capsid protein -
  PMCN06_RS00475 (PMCN06_0092) - 71371..71667 (+) 297 WP_014390744.1 hypothetical protein -
  PMCN06_RS00480 (PMCN06_0093) - 71648..72016 (+) 369 WP_014390745.1 hypothetical protein -
  PMCN06_RS00485 (PMCN06_0094) - 72019..72363 (+) 345 WP_014390746.1 hypothetical protein -
  PMCN06_RS00490 (PMCN06_0095) - 72368..72739 (+) 372 WP_014390747.1 hypothetical protein -
  PMCN06_RS00495 (PMCN06_0096) - 72736..73107 (+) 372 WP_014390748.1 hypothetical protein -
  PMCN06_RS00500 (PMCN06_0097) - 73119..73601 (+) 483 WP_014390749.1 phage tail tube protein -
  PMCN06_RS00505 (PMCN06_0098) - 73655..74326 (+) 672 WP_014390750.1 DUF6246 family protein -
  PMCN06_RS00510 (PMCN06_0099) - 74403..74759 (+) 357 WP_014390751.1 TM2 domain-containing protein -
  PMCN06_RS00515 (PMCN06_0100) - 74835..75653 (-) 819 WP_014390752.1 hypothetical protein -
  PMCN06_RS00520 (PMCN06_0102) - 75992..76816 (+) 825 WP_014390754.1 phage antirepressor N-terminal domain-containing protein -
  PMCN06_RS00525 (PMCN06_0103) - 76868..79312 (+) 2445 WP_014390755.1 phage tail length tape measure family protein -
  PMCN06_RS00530 (PMCN06_0104) - 79315..79644 (+) 330 WP_014390756.1 phage tail protein -
  PMCN06_RS00535 (PMCN06_0106) - 79773..80477 (+) 705 WP_014390758.1 phage minor tail protein L -
  PMCN06_RS00540 (PMCN06_0107) - 80482..81225 (+) 744 WP_041423052.1 C40 family peptidase -
  PMCN06_RS00545 (PMCN06_0108) - 81168..81788 (+) 621 WP_014667799.1 tail assembly protein -
  PMCN06_RS00550 (PMCN06_0109) - 81792..85106 (+) 3315 WP_228376245.1 host specificity protein J -
  PMCN06_RS11795 - 85124..86794 (+) 1671 WP_228376246.1 DUF1983 domain-containing protein -
  PMCN06_RS00555 (PMCN06_0111) - 86842..87165 (+) 324 WP_014390761.1 hypothetical protein -
  PMCN06_RS00560 (PMCN06_0112) - 87556..88302 (-) 747 WP_014390762.1 hypothetical protein -
  PMCN06_RS00565 (PMCN06_0113) - 88302..88814 (-) 513 WP_014390763.1 hypothetical protein -

Sequence

Protein


Download         Length: 150 a.a.        Molecular weight: 17063.94 Da        Isoelectric Point: 7.9707

>NTDB_id=44265 PMCN06_RS00280 WP_014390703.1 45035..45487(-) (ssb) [Pasteurella multocida subsp. multocida str. HN06]
MAGVNKVIIVGNLGNDPEIRTMPNGDPVAKISVATSESWIDKNTGERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQAYNFEEDNIPF

Nucleotide


Download         Length: 453 bp        

>NTDB_id=44265 PMCN06_RS00280 WP_014390703.1 45035..45487(-) (ssb) [Pasteurella multocida subsp. multocida str. HN06]
ATGGCAGGTGTTAATAAAGTAATTATCGTGGGAAATTTGGGAAACGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTTGCAAAAATCAGCGTCGCAACCAGTGAAAGCTGGATCGACAAAAATACTGGCGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGTCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCATATAACTTTGAAGAGGATAATATCCCATTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

62.222

100

0.747
  ssb Vibrio cholerae strain A1552

53.957

92.667

0.5
  ssb Neisseria gonorrhoeae MS11

46.715

91.333

0.427
  ssb Neisseria meningitidis MC58

46.715

91.333

0.427

Multiple sequence alignment