Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   HG538_RS13770 Genome accession   NZ_CP053045
Coordinates   2839364..2839870 (+) Length   168 a.a.
NCBI ID   WP_000168274.1    Uniprot ID   A0A9X0Q0X8
Organism   Escherichia fergusonii strain HNCF11W     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2802864..2842633 2839364..2839870 within 0


Gene organization within MGE regions


Location: 2802864..2842633
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG538_RS13495 (HG538_13505) - 2802864..2803253 (-) 390 WP_171882074.1 S24 family peptidase -
  HG538_RS13500 (HG538_13510) - 2803357..2804388 (-) 1032 WP_104726698.1 acyltransferase -
  HG538_RS13505 (HG538_13515) - 2804449..2806491 (-) 2043 WP_171882075.1 phage head-binding domain-containing protein -
  HG538_RS13510 (HG538_13520) - 2806763..2807182 (-) 420 WP_032219545.1 hypothetical protein -
  HG538_RS13515 (HG538_13525) - 2807187..2807630 (-) 444 WP_032219532.1 type II toxin-antitoxin system antitoxin SocA domain-containing protein -
  HG538_RS13520 (HG538_13530) - 2808009..2808494 (+) 486 WP_016231948.1 hypothetical protein -
  HG538_RS23335 - 2808576..2808665 (+) 90 Protein_2647 Arc family DNA-binding protein -
  HG538_RS13530 (HG538_13540) - 2808683..2810914 (-) 2232 WP_253940420.1 hypothetical protein -
  HG538_RS13535 (HG538_13545) - 2810911..2812323 (-) 1413 WP_171882076.1 phage DNA ejection protein -
  HG538_RS13540 (HG538_13550) - 2812333..2813013 (-) 681 WP_001544386.1 hypothetical protein -
  HG538_RS13545 (HG538_13555) - 2813000..2813467 (-) 468 WP_046082882.1 DUF2824 family protein -
  HG538_RS13550 (HG538_13560) - 2813467..2814315 (-) 849 WP_171882077.1 tail needle knob protein -
  HG538_RS13555 (HG538_13565) - 2814315..2815733 (-) 1419 WP_171882078.1 packaged DNA stabilization protein gp10 -
  HG538_RS13560 (HG538_13570) - 2815743..2816204 (-) 462 WP_001140510.1 packaged DNA stabilization gp4 family protein -
  HG538_RS13565 (HG538_13575) - 2816185..2816373 (-) 189 WP_069905690.1 hypothetical protein -
  HG538_RS13570 (HG538_13580) - 2816415..2817668 (-) 1254 WP_016248918.1 P22 phage major capsid protein family protein -
  HG538_RS13575 (HG538_13585) - 2817687..2818580 (-) 894 WP_021560734.1 phage scaffold protein -
  HG538_RS13580 (HG538_13590) - 2818671..2820869 (-) 2199 WP_171882079.1 portal protein -
  HG538_RS13585 (HG538_13595) - 2820871..2822286 (-) 1416 WP_171882080.1 PBSX family phage terminase large subunit -
  HG538_RS13590 (HG538_13600) - 2822283..2822723 (-) 441 WP_000113732.1 hypothetical protein -
  HG538_RS13595 (HG538_13605) - 2822726..2822968 (-) 243 WP_000807788.1 DUF2560 family protein -
  HG538_RS13600 (HG538_13610) - 2823072..2823443 (-) 372 WP_000999679.1 Gp49 family protein -
  HG538_RS13605 (HG538_13615) - 2823622..2824107 (-) 486 WP_001058931.1 GIY-YIG nuclease family protein -
  HG538_RS13610 (HG538_13620) - 2824309..2824461 (-) 153 WP_001139680.1 hypothetical protein -
  HG538_RS13615 (HG538_13625) - 2824449..2824886 (-) 438 WP_171882081.1 lysis protein -
  HG538_RS13620 (HG538_13630) - 2824883..2825359 (-) 477 WP_000229392.1 glycoside hydrolase family protein -
  HG538_RS13625 (HG538_13635) - 2825343..2825666 (-) 324 WP_000783734.1 phage holin, lambda family -
  HG538_RS13640 (HG538_13650) - 2826156..2826644 (-) 489 WP_000512806.1 antiterminator Q family protein -
  HG538_RS13645 (HG538_13655) - 2826635..2827306 (-) 672 WP_171882082.1 serine/threonine protein phosphatase -
  HG538_RS13650 (HG538_13660) - 2827284..2827490 (-) 207 WP_000144614.1 phage NinH family protein -
  HG538_RS13655 (HG538_13665) - 2827487..2828098 (-) 612 WP_171882083.1 recombination protein NinG -
  HG538_RS13660 (HG538_13670) - 2828098..2828367 (-) 270 WP_113415686.1 hypothetical protein -
  HG538_RS13665 (HG538_13675) - 2828360..2828569 (-) 210 WP_171882084.1 protein NinF -
  HG538_RS13670 (HG538_13680) - 2828529..2828930 (-) 402 WP_023486201.1 hypothetical protein -
  HG538_RS13675 (HG538_13685) - 2828933..2829108 (-) 176 Protein_2675 NinE family protein -
  HG538_RS13680 (HG538_13690) - 2829105..2829950 (-) 846 WP_052938503.1 phosphoadenosine phosphosulfate reductase family protein -
  HG538_RS13685 (HG538_13695) - 2829947..2830387 (-) 441 WP_052938504.1 recombination protein NinB -
  HG538_RS13690 (HG538_13700) - 2830612..2830932 (-) 321 WP_171882085.1 hypothetical protein -
  HG538_RS13695 (HG538_13705) - 2831621..2831890 (-) 270 WP_001036029.1 hypothetical protein -
  HG538_RS13700 (HG538_13710) - 2831890..2833326 (-) 1437 WP_171882086.1 DnaB-like helicase C-terminal domain-containing protein -
  HG538_RS13705 (HG538_13715) - 2833316..2834215 (-) 900 WP_057697610.1 hypothetical protein -
  HG538_RS13710 (HG538_13720) - 2834208..2834354 (-) 147 WP_000166207.1 DUF2740 family protein -
  HG538_RS13715 (HG538_13725) - 2834387..2834683 (-) 297 WP_000438527.1 CII family transcriptional regulator -
  HG538_RS13720 (HG538_13730) - 2834825..2835040 (-) 216 WP_000067727.1 helix-turn-helix transcriptional regulator -
  HG538_RS13725 (HG538_13735) - 2835116..2835811 (+) 696 WP_016242500.1 LexA family transcriptional regulator -
  HG538_RS13730 (HG538_13740) - 2835957..2836179 (+) 223 Protein_2686 hypothetical protein -
  HG538_RS13735 (HG538_13745) - 2836157..2836429 (+) 273 WP_000088201.1 hypothetical protein -
  HG538_RS13740 (HG538_13750) - 2836488..2836958 (+) 471 WP_000167595.1 hypothetical protein -
  HG538_RS13745 (HG538_13755) - 2837141..2838109 (+) 969 WP_072971834.1 cell envelope biogenesis protein TolA -
  HG538_RS13750 (HG538_13760) - 2838133..2838264 (+) 132 WP_000638547.1 protease FtsH-inhibitory lysogeny factor CIII -
  HG538_RS13755 (HG538_13765) kil 2838249..2838401 (+) 153 WP_001243355.1 host cell division inhibitory peptide Kil -
  HG538_RS13760 (HG538_13770) - 2838477..2838647 (+) 171 WP_000050554.1 hypothetical protein -
  HG538_RS13765 (HG538_13775) - 2838656..2839363 (+) 708 WP_000365280.1 Rad52/Rad22 family DNA repair protein -
  HG538_RS13770 (HG538_13780) ssb 2839364..2839870 (+) 507 WP_000168274.1 single-stranded DNA-binding protein Machinery gene
  HG538_RS13775 (HG538_13785) - 2839884..2840177 (+) 294 WP_001111303.1 phage anti-RecBCD protein -
  HG538_RS13780 (HG538_13790) - 2840188..2840352 (+) 165 WP_001459566.1 DUF2737 family protein -
  HG538_RS13785 (HG538_13795) - 2840349..2840867 (+) 519 WP_171882087.1 hypothetical protein -
  HG538_RS13790 (HG538_13800) - 2840864..2841133 (+) 270 WP_171882088.1 hypothetical protein -
  HG538_RS13795 (HG538_13805) - 2841283..2841474 (+) 192 WP_000132739.1 AlpA family transcriptional regulator -
  HG538_RS13800 (HG538_13810) - 2841455..2842633 (-) 1179 WP_001007947.1 site-specific integrase -

Sequence


Protein


Download         Length: 168 a.a.        Molecular weight: 18731.03 Da        Isoelectric Point: 8.4877

>NTDB_id=442453 HG538_RS13770 WP_000168274.1 2839364..2839870(+) (ssb) [Escherichia fergusonii strain HNCF11W]
MASRGVNKVIILGRVGQDPEVRYSPSGTAFANLTIATSEQWRDKNTGEQKELTEWHRVAVSGKLAEVVGQYVKKGDQIYF
EGMLRTRKWKDQSGQDRYTTEVHVGINGVMQMLGGIGDSKQQAASRQSQKPQQQSSPAQHNEPPMDFDDDIPFAPVTLPF
PRHAIHAI

Nucleotide


Download         Length: 507 bp        

>NTDB_id=442453 HG538_RS13770 WP_000168274.1 2839364..2839870(+) (ssb) [Escherichia fergusonii strain HNCF11W]
ATGGCAAGCAGAGGCGTAAATAAGGTGATTATCCTTGGTCGGGTAGGACAAGACCCGGAAGTTCGATACTCACCATCAGG
AACAGCGTTCGCTAACCTGACAATAGCCACGTCAGAACAATGGCGAGATAAAAATACTGGCGAGCAAAAGGAATTAACTG
AATGGCATCGTGTTGCTGTATCCGGGAAACTGGCTGAGGTCGTGGGGCAGTATGTGAAAAAAGGTGATCAGATTTATTTC
GAGGGAATGCTGAGAACCAGAAAGTGGAAAGACCAGTCAGGGCAAGACCGTTACACAACCGAGGTTCATGTCGGAATTAA
TGGCGTGATGCAAATGCTTGGCGGCATTGGCGACAGCAAACAACAAGCAGCCAGCAGGCAATCACAGAAGCCACAGCAGC
AATCATCACCAGCACAACACAACGAACCTCCGATGGATTTTGACGACGATATACCCTTTGCACCAGTAACTCTCCCCTTC
CCTCGTCACGCTATTCACGCAATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

62.147

100

0.655

  ssb Glaesserella parasuis strain SC1401

45.856

100

0.494

  ssb Neisseria meningitidis MC58

38.636

100

0.405

  ssb Neisseria gonorrhoeae MS11

38.636

100

0.405