Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   HKJ31_RS03550 Genome accession   NZ_CP052855
Coordinates   781868..782314 (-) Length   148 a.a.
NCBI ID   WP_021358633.1    Uniprot ID   -
Organism   Xylella fastidiosa subsp. multiplex strain Fillmore     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 768320..801250 781868..782314 within 0


Gene organization within MGE regions


Location: 768320..801250
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HKJ31_RS03480 (HKJ31_03560) ispF 768320..768823 (+) 504 WP_004084001.1 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase -
  HKJ31_RS03485 (HKJ31_03565) - 769035..769574 (-) 540 WP_004083998.1 Smr/MutS family protein -
  HKJ31_RS03490 (HKJ31_03570) - 770059..771075 (-) 1017 WP_004083996.1 SMP-30/gluconolactonase/LRE family protein -
  HKJ31_RS03495 (HKJ31_03575) - 771214..772860 (-) 1647 WP_004083995.1 electron transfer flavoprotein-ubiquinone oxidoreductase -
  HKJ31_RS03500 (HKJ31_03580) - 772968..773552 (+) 585 WP_004083991.1 alpha-ketoglutarate-dependent dioxygenase AlkB -
  HKJ31_RS03505 (HKJ31_03585) - 773747..774388 (-) 642 WP_004083987.1 ABC-type transport auxiliary lipoprotein family protein -
  HKJ31_RS03510 (HKJ31_03590) - 774385..775311 (-) 927 WP_004083985.1 MlaD family protein -
  HKJ31_RS03515 (HKJ31_03595) - 775315..776145 (-) 831 WP_004083974.1 ABC transporter ATP-binding protein -
  HKJ31_RS03520 (HKJ31_03600) - 776151..777269 (-) 1119 WP_004083972.1 ABC transporter permease -
  HKJ31_RS03525 (HKJ31_03605) - 777379..778641 (+) 1263 WP_012337721.1 threonine/serine exporter family protein -
  HKJ31_RS03530 (HKJ31_03615) - 779282..779488 (+) 207 WP_071869858.1 hypothetical protein -
  HKJ31_RS03535 (HKJ31_03620) - 779552..779761 (+) 210 WP_225621843.1 hypothetical protein -
  HKJ31_RS03540 (HKJ31_03625) - 780402..781574 (-) 1173 WP_004083967.1 integrase -
  HKJ31_RS03545 (HKJ31_03630) - 781574..781846 (-) 273 WP_004083966.1 hypothetical protein -
  HKJ31_RS03550 (HKJ31_03635) ssb 781868..782314 (-) 447 WP_021358633.1 single-stranded DNA-binding protein Machinery gene
  HKJ31_RS03555 (HKJ31_03640) - 782298..782747 (-) 450 WP_154128301.1 DUF5131 family protein -
  HKJ31_RS03560 (HKJ31_03645) - 782740..782970 (-) 231 WP_021358635.1 hypothetical protein -
  HKJ31_RS03565 (HKJ31_03650) - 782970..783503 (-) 534 WP_004083962.1 hypothetical protein -
  HKJ31_RS03570 (HKJ31_03655) - 783500..784093 (-) 594 WP_004083960.1 DapH/DapD/GlmU-related protein -
  HKJ31_RS03575 (HKJ31_03660) - 784186..784719 (-) 534 WP_012337723.1 pilin -
  HKJ31_RS03580 (HKJ31_03665) - 784852..785118 (-) 267 WP_004084112.1 hypothetical protein -
  HKJ31_RS03585 (HKJ31_03670) - 785115..785393 (-) 279 WP_004083957.1 hypothetical protein -
  HKJ31_RS03590 (HKJ31_03675) - 785390..785611 (-) 222 WP_021358638.1 hypothetical protein -
  HKJ31_RS03595 (HKJ31_03680) - 785608..786066 (-) 459 WP_004084109.1 hypothetical protein -
  HKJ31_RS03600 (HKJ31_03685) - 786063..786527 (-) 465 WP_021358639.1 DUF1566 domain-containing protein -
  HKJ31_RS03605 (HKJ31_03690) - 786524..787021 (-) 498 WP_021358640.1 hypothetical protein -
  HKJ31_RS03610 (HKJ31_03695) - 787011..787634 (+) 624 WP_004083954.1 hypothetical protein -
  HKJ31_RS03615 (HKJ31_03700) - 787736..788137 (-) 402 WP_169710336.1 hypothetical protein -
  HKJ31_RS03620 (HKJ31_03705) - 788136..788624 (+) 489 WP_238836475.1 CHC2 zinc finger domain-containing protein -
  HKJ31_RS03625 (HKJ31_03710) - 788560..789204 (+) 645 WP_228762222.1 terminase gpA endonuclease subunit -
  HKJ31_RS03630 (HKJ31_03715) - 789281..789517 (+) 237 WP_012337727.1 hypothetical protein -
  HKJ31_RS03635 (HKJ31_03720) - 789514..790029 (+) 516 WP_004083947.1 phage portal protein -
  HKJ31_RS11485 - 790194..790436 (+) 243 WP_228762223.1 hypothetical protein -
  HKJ31_RS11875 - 790450..790572 (+) 123 WP_324187556.1 hypothetical protein -
  HKJ31_RS03645 (HKJ31_03730) - 790563..790991 (+) 429 WP_004083945.1 hypothetical protein -
  HKJ31_RS03650 (HKJ31_03735) - 790988..791224 (+) 237 WP_004083943.1 hypothetical protein -
  HKJ31_RS03655 (HKJ31_03740) - 791214..794039 (+) 2826 WP_169710337.1 phage tail protein -
  HKJ31_RS03660 (HKJ31_03745) - 794032..794544 (+) 513 WP_169709957.1 hypothetical protein -
  HKJ31_RS03665 (HKJ31_03750) - 794548..794967 (+) 420 WP_004083636.1 hypothetical protein -
  HKJ31_RS03670 (HKJ31_03755) - 795076..795738 (+) 663 WP_249330857.1 hypothetical protein -
  HKJ31_RS11795 - 795798..795926 (-) 129 WP_256704593.1 hypothetical protein -
  HKJ31_RS03680 (HKJ31_03765) - 795974..796081 (+) 108 Protein_715 DNA adenine methylase -
  HKJ31_RS03685 (HKJ31_03770) - 796133..796759 (+) 627 WP_038230952.1 IS607 family transposase -
  HKJ31_RS03690 (HKJ31_03775) - 796753..797949 (+) 1197 WP_004083925.1 RNA-guided endonuclease TnpB family protein -
  HKJ31_RS03695 (HKJ31_03780) - 797956..798660 (+) 705 WP_154123795.1 DNA adenine methylase -
  HKJ31_RS03700 (HKJ31_03785) - 799379..799678 (-) 300 WP_004084250.1 hypothetical protein -
  HKJ31_RS03705 (HKJ31_03790) - 800038..800280 (-) 243 WP_020851762.1 hypothetical protein -
  HKJ31_RS03710 (HKJ31_03795) - 800686..801003 (-) 318 WP_004084245.1 BrnA antitoxin family protein -
  HKJ31_RS03715 (HKJ31_03800) - 800963..801250 (-) 288 WP_004083921.1 BrnT family toxin -

Sequence


Protein


Download         Length: 148 a.a.        Molecular weight: 16536.38 Da        Isoelectric Point: 6.4871

>NTDB_id=441742 HKJ31_RS03550 WP_021358633.1 781868..782314(-) (ssb) [Xylella fastidiosa subsp. multiplex strain Fillmore]
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGQDGQERYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF

Nucleotide


Download         Length: 447 bp        

>NTDB_id=441742 HKJ31_RS03550 WP_021358633.1 781868..782314(-) (ssb) [Xylella fastidiosa subsp. multiplex strain Fillmore]
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTTGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCCAGGACGGTCAGGAGCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

41.477

100

0.493

  ssb Neisseria meningitidis MC58

38.728

100

0.453

  ssb Neisseria gonorrhoeae MS11

38.728

100

0.453

  ssb Glaesserella parasuis strain SC1401

41.304

93.243

0.385