Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   SAMSHR1132_RS09720 Genome accession   NC_016941
Coordinates   2000190..2000660 (-) Length   156 a.a.
NCBI ID   WP_000934772.1    Uniprot ID   -
Organism   Staphylococcus argenteus     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1970692..2021617 2000190..2000660 within 0


Gene organization within MGE regions


Location: 1970692..2021617
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SAMSHR1132_RS09510 (SAMSHR1132_17850) scn 1970692..1971042 (-) 351 WP_000702262.1 complement inhibitor SCIN-A -
  SAMSHR1132_RS13855 (SAMSHR1132_17860) - 1971553..1971891 (-) 339 Protein_1819 SH3 domain-containing protein -
  SAMSHR1132_RS09520 (SAMSHR1132_17870) sak 1972539..1973030 (-) 492 WP_000920035.1 staphylokinase -
  SAMSHR1132_RS09525 (SAMSHR1132_17880) - 1973221..1973976 (-) 756 WP_000861030.1 CHAP domain-containing protein -
  SAMSHR1132_RS09530 (SAMSHR1132_17890) - 1973988..1974242 (-) 255 WP_000611512.1 phage holin -
  SAMSHR1132_RS09535 - 1974294..1974401 (+) 108 WP_001791821.1 hypothetical protein -
  SAMSHR1132_RS13870 pepG1 1974454..1974588 (-) 135 WP_000226108.1 type I toxin-antitoxin system toxin PepG1 -
  SAMSHR1132_RS09545 (SAMSHR1132_17900) - 1974780..1975076 (-) 297 WP_000539688.1 DUF2951 domain-containing protein -
  SAMSHR1132_RS09550 (SAMSHR1132_17910) - 1975134..1975421 (-) 288 WP_001040256.1 hypothetical protein -
  SAMSHR1132_RS09555 (SAMSHR1132_17920) - 1975468..1975620 (-) 153 WP_001153681.1 hypothetical protein -
  SAMSHR1132_RS09560 (SAMSHR1132_17930) - 1975610..1979395 (-) 3786 WP_000582188.1 phage tail spike protein -
  SAMSHR1132_RS09565 (SAMSHR1132_17940) - 1979411..1980895 (-) 1485 WP_000567390.1 phage distal tail protein -
  SAMSHR1132_RS09570 (SAMSHR1132_17950) - 1980892..1985421 (-) 4530 WP_014373866.1 phage tail tape measure protein -
  SAMSHR1132_RS14130 (SAMSHR1132_17960) gpGT 1985478..1985615 (-) 138 WP_001549167.1 phage tail assembly chaperone GT -
  SAMSHR1132_RS09580 (SAMSHR1132_17970) gpG 1985666..1986016 (-) 351 WP_001096355.1 phage tail assembly chaperone G -
  SAMSHR1132_RS13875 - 1986066..1986290 (-) 225 WP_072050172.1 Ig-like domain-containing protein -
  SAMSHR1132_RS09585 (SAMSHR1132_17980) - 1986332..1986976 (-) 645 WP_000268732.1 major tail protein -
  SAMSHR1132_RS09590 (SAMSHR1132_17990) - 1986977..1987384 (-) 408 WP_000565495.1 hypothetical protein -
  SAMSHR1132_RS09595 (SAMSHR1132_18000) - 1987381..1987785 (-) 405 WP_000114225.1 HK97 gp10 family phage protein -
  SAMSHR1132_RS09600 (SAMSHR1132_18010) - 1987782..1988144 (-) 363 WP_001231000.1 head-tail adaptor protein -
  SAMSHR1132_RS09605 (SAMSHR1132_18020) - 1988128..1988409 (-) 282 WP_000344038.1 phage head-tail adapter protein -
  SAMSHR1132_RS09610 (SAMSHR1132_18030) - 1988418..1988696 (-) 279 WP_000005716.1 hypothetical protein -
  SAMSHR1132_RS09615 (SAMSHR1132_18040) - 1988715..1989854 (-) 1140 WP_000216654.1 phage major capsid protein -
  SAMSHR1132_RS09620 (SAMSHR1132_18050) - 1989878..1990600 (-) 723 WP_000700968.1 head maturation protease, ClpP-related -
  SAMSHR1132_RS09625 (SAMSHR1132_18060) - 1990597..1991745 (-) 1149 WP_000511812.1 phage portal protein -
  SAMSHR1132_RS09630 (SAMSHR1132_18070) - 1991760..1993421 (-) 1662 WP_000625099.1 terminase large subunit -
  SAMSHR1132_RS09635 (SAMSHR1132_18080) - 1993418..1993762 (-) 345 WP_000402904.1 hypothetical protein -
  SAMSHR1132_RS09640 (SAMSHR1132_18090) - 1993892..1994191 (-) 300 WP_000988336.1 HNH endonuclease -
  SAMSHR1132_RS09645 (SAMSHR1132_18100) - 1994423..1994839 (-) 417 WP_000590126.1 hypothetical protein -
  SAMSHR1132_RS09650 (SAMSHR1132_18110) - 1994867..1995067 (-) 201 WP_000265041.1 DUF1514 family protein -
  SAMSHR1132_RS09655 (SAMSHR1132_18120) rinB 1995067..1995216 (-) 150 WP_000237868.1 transcriptional activator RinB -
  SAMSHR1132_RS09660 (SAMSHR1132_18130) - 1995219..1995419 (-) 201 WP_001125015.1 hypothetical protein -
  SAMSHR1132_RS09665 (SAMSHR1132_18140) - 1995394..1995582 (-) 189 WP_000195837.1 DUF1381 domain-containing protein -
  SAMSHR1132_RS09670 (SAMSHR1132_18150) - 1995619..1996161 (-) 543 WP_000181814.1 dUTP diphosphatase -
  SAMSHR1132_RS14245 - 1996517..1996642 (-) 126 Protein_1852 DUF1024 family protein -
  SAMSHR1132_RS09680 (SAMSHR1132_18170) - 1996635..1997045 (-) 411 WP_000197966.1 hypothetical protein -
  SAMSHR1132_RS13580 (SAMSHR1132_18180) - 1997204..1997551 (-) 348 WP_001105606.1 hypothetical protein -
  SAMSHR1132_RS09690 (SAMSHR1132_18190) - 1997548..1997982 (-) 435 WP_001127465.1 YopX family protein -
  SAMSHR1132_RS09695 (SAMSHR1132_18200) - 1997996..1998244 (-) 249 WP_001126845.1 phi PVL orf 51-like protein -
  SAMSHR1132_RS09700 (SAMSHR1132_18210) - 1998245..1998616 (-) 372 WP_000101281.1 SA1788 family PVL leukocidin-associated protein -
  SAMSHR1132_RS09705 (SAMSHR1132_18220) - 1998629..1999033 (-) 405 WP_000401958.1 RusA family crossover junction endodeoxyribonuclease -
  SAMSHR1132_RS09710 (SAMSHR1132_18230) - 1999042..1999260 (-) 219 WP_000338530.1 hypothetical protein -
  SAMSHR1132_RS09715 (SAMSHR1132_18240) - 1999267..2000160 (-) 894 WP_000148334.1 DnaD domain-containing protein -
  SAMSHR1132_RS09720 (SAMSHR1132_18250) ssbA 2000190..2000660 (-) 471 WP_000934772.1 single-stranded DNA-binding protein Machinery gene
  SAMSHR1132_RS09725 (SAMSHR1132_18260) - 2000661..2001278 (-) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  SAMSHR1132_RS09730 (SAMSHR1132_18270) - 2001359..2002279 (-) 921 WP_000138479.1 recombinase RecT -
  SAMSHR1132_RS09735 (SAMSHR1132_18280) - 2002281..2004236 (-) 1956 Protein_1864 ATPase -
  SAMSHR1132_RS13880 (SAMSHR1132_18300) - 2004233..2004496 (-) 264 WP_001205732.1 hypothetical protein -
  SAMSHR1132_RS09740 (SAMSHR1132_18310) - 2004505..2004765 (-) 261 WP_000291505.1 DUF1108 family protein -
  SAMSHR1132_RS09745 (SAMSHR1132_18320) - 2004805..2005065 (-) 261 WP_001817285.1 DUF2482 family protein -
  SAMSHR1132_RS09750 (SAMSHR1132_18330) - 2005160..2005321 (-) 162 WP_000066009.1 DUF1270 domain-containing protein -
  SAMSHR1132_RS09755 (SAMSHR1132_18340) - 2005318..2005638 (-) 321 WP_001120197.1 DUF771 domain-containing protein -
  SAMSHR1132_RS09760 (SAMSHR1132_18350) - 2005697..2006329 (+) 633 WP_000275058.1 hypothetical protein -
  SAMSHR1132_RS09765 (SAMSHR1132_18360) - 2006344..2006484 (-) 141 WP_000939496.1 hypothetical protein -
  SAMSHR1132_RS09770 (SAMSHR1132_18370) - 2006515..2006712 (-) 198 WP_001148861.1 hypothetical protein -
  SAMSHR1132_RS09775 (SAMSHR1132_18380) - 2006728..2007477 (-) 750 WP_001148653.1 phage antirepressor KilAC domain-containing protein -
  SAMSHR1132_RS09780 (SAMSHR1132_18390) - 2007534..2008073 (+) 540 WP_000351243.1 hypothetical protein -
  SAMSHR1132_RS09785 (SAMSHR1132_18400) - 2008097..2008357 (-) 261 WP_000435337.1 hypothetical protein -
  SAMSHR1132_RS09790 (SAMSHR1132_18410) - 2008375..2008599 (-) 225 WP_000338186.1 DUF739 family protein -
  SAMSHR1132_RS09795 (SAMSHR1132_18420) - 2008758..2009528 (+) 771 WP_001208476.1 S24 family peptidase -
  SAMSHR1132_RS09800 (SAMSHR1132_18430) - 2009728..2009910 (+) 183 WP_000705240.1 hypothetical protein -
  SAMSHR1132_RS09805 (SAMSHR1132_18440) - 2009988..2010701 (+) 714 WP_001549185.1 type II toxin-antitoxin system PemK/MazF family toxin -
  SAMSHR1132_RS09810 (SAMSHR1132_18450) - 2010892..2011929 (+) 1038 WP_000857198.1 site-specific integrase -
  SAMSHR1132_RS09815 (SAMSHR1132_17840) sph 2011986..2012810 (+) 825 Protein_1881 sphingomyelin phosphodiesterase -
  SAMSHR1132_RS09820 (SAMSHR1132_18470) - 2013386..2014402 (-) 1017 WP_000595211.1 leukocidin/hemolysin toxin family protein -
  SAMSHR1132_RS09825 (SAMSHR1132_18480) - 2014424..2015476 (-) 1053 WP_000791422.1 leukocidin family pore-forming toxin -
  SAMSHR1132_RS09830 (SAMSHR1132_18490) - 2015903..2017126 (+) 1224 WP_000206643.1 ArgE/DapE family deacylase -
  SAMSHR1132_RS09835 (SAMSHR1132_18500) - 2017744..2019051 (+) 1308 WP_001045060.1 TrkH family potassium uptake protein -
  SAMSHR1132_RS09840 (SAMSHR1132_18510) groL 2019645..2021261 (-) 1617 WP_001118817.1 chaperonin GroEL -
  SAMSHR1132_RS09845 (SAMSHR1132_18520) groES 2021333..2021617 (-) 285 WP_000917286.1 co-chaperone GroES -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17657.52 Da        Isoelectric Point: 5.2672

>NTDB_id=44172 SAMSHR1132_RS09720 WP_000934772.1 2000190..2000660(-) (ssbA) [Staphylococcus argenteus]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=44172 SAMSHR1132_RS09720 WP_000934772.1 2000190..2000660(-) (ssbA) [Staphylococcus argenteus]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Vibrio cholerae strain A1552

31.492

100

0.365


Multiple sequence alignment