Detailed information NTG0044096

Bioinformatically predicted

Overview

• Name: nucA/comI
• Type: Machinery gene
• Locus tag: PM3016_RS19160
• Genome accession: NC_016935
• Coordinates: 4455607..4456032 (-)
• Length: 141 a.a.
• NCBI ID: WP_041619176.1
• Uniprot ID: -
• Organism: Paenibacillus mucilaginosus 3016
• Function: cleavage of dsDNA into ssDNA (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	4444535..4463627	4455607..4456032	within	0

Gene organization within MGE regions

Location: 4444535..4463627

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PM3016_RS19130 (PM3016_3869)	-	4444535..4445431 (-)	897	WP_014370583.1	DMT family transporter	-
PM3016_RS19135 (PM3016_3870)	-	4445951..4447195 (+)	1245	WP_013918143.1	hypothetical protein	-
PM3016_RS36785 (PM3016_3871)	-	4447339..4450248 (-)	2910	WP_014370584.1	S-layer homology domain-containing protein	-
PM3016_RS19150 (PM3016_3872)	-	4450332..4451384 (-)	1053	WP_014370585.1	Ig-like domain-containing protein	-
PM3016_RS38745 (PM3016_3873)	-	4451392..4451568 (-)	177	WP_014370586.1	hypothetical protein	-
PM3016_RS19155 (PM3016_3874)	-	4451513..4455421 (-)	3909	WP_014370587.1	Ig-like domain-containing protein	-
PM3016_RS19160 (PM3016_3875)	nucA/comI	4455607..4456032 (-)	426	WP_041619176.1	NucA/NucB deoxyribonuclease domain-containing protein	Machinery gene
PM3016_RS19165 (PM3016_3876)	-	4456098..4456553 (-)	456	WP_014370589.1	MarR family winged helix-turn-helix transcriptional regulator	-
PM3016_RS19170 (PM3016_3877)	-	4456706..4457626 (+)	921	WP_014370590.1	SDR family NAD(P)-dependent oxidoreductase	-
PM3016_RS19175 (PM3016_3878)	-	4457576..4458667 (-)	1092	WP_238540244.1	vWA domain-containing protein	-
PM3016_RS19180 (PM3016_3879)	-	4458698..4459789 (-)	1092	WP_041619177.1	AAA family ATPase	-
PM3016_RS19185 (PM3016_3880)	-	4459814..4460293 (-)	480	WP_014370591.1	DUF6530 family protein	-
PM3016_RS19190 (PM3016_3881)	-	4460535..4461452 (-)	918	WP_013918147.1	alpha/beta hydrolase	-
PM3016_RS19195 (PM3016_3882)	-	4461483..4462334 (+)	852	WP_014370592.1	helix-turn-helix transcriptional regulator	-
PM3016_RS19200 (PM3016_3883)	-	4462398..4462955 (-)	558	WP_014370593.1	NADAR family protein	-
PM3016_RS19205 (PM3016_3884)	-	4462980..4463627 (-)	648	WP_014370594.1	HAD family hydrolase	-

Sequence

Protein

• Length: 141 a.a.
• Molecular weight: 15803.03 Da
• Isoelectric Point: 4.4812

>NTDB_id=44096 PM3016_RS19160 WP_041619176.1 4455607..4456032(-) (nucA/comI) [Paenibacillus mucilaginosus 3016]
MKKVRLIVQMIFFLILAIVVFQVLGEQDTQQPDGVDYTLILPADRYPETLKHIREAIAEGESAVCTIDREGAEENRKESL
KGIPTKKGYDRDEWPMAMCAEGGTGADVEYVPFADNRGAGSWIGNQLERFPDGSRILFQLP

Nucleotide

• Length: 426 bp

>NTDB_id=44096 PM3016_RS19160 WP_041619176.1 4455607..4456032(-) (nucA/comI) [Paenibacillus mucilaginosus 3016]
ATGAAGAAGGTGCGCTTGATCGTTCAGATGATATTTTTTCTCATCCTTGCTATTGTTGTATTTCAAGTTCTTGGAGAACA
GGATACACAGCAGCCAGACGGCGTAGACTATACGCTGATTCTGCCGGCGGACCGGTATCCCGAGACGCTGAAGCATATCC
GGGAGGCTATAGCCGAAGGGGAATCGGCTGTGTGTACGATTGACCGGGAGGGGGCGGAGGAGAACCGCAAAGAATCGCTG
AAAGGCATTCCGACGAAAAAGGGCTACGACCGGGATGAGTGGCCTATGGCGATGTGTGCCGAGGGCGGCACCGGTGCGGA
TGTAGAGTATGTGCCCTTCGCGGATAATAGGGGGGCAGGCTCATGGATCGGCAATCAGCTCGAGCGGTTCCCGGACGGAA
GCCGGATTTTATTTCAATTGCCATAA

Domains

Predicted by InterproScan.

• Deoxyribonuclease NucA/NucB (DNase_NucA_NucB) (46-134)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
nucA/comI	Bacillus subtilis subsp. subtilis str. 168	63.478	81.56	0.518