Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   HHJ56_RS01290 Genome accession   NZ_CP051642
Coordinates   259674..260153 (-) Length   159 a.a.
NCBI ID   WP_035689249.1    Uniprot ID   -
Organism   Avibacterium paragallinarum strain ADL-AP01     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 244535..292406 259674..260153 within 0


Gene organization within MGE regions


Location: 244535..292406
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HHJ56_RS01170 (HHJ56_01170) cgtA 244535..245707 (-) 1173 WP_035688649.1 Obg family GTPase CgtA -
  HHJ56_RS01175 (HHJ56_01175) - 245716..246636 (-) 921 WP_035688648.1 DMT family transporter -
  HHJ56_RS01180 (HHJ56_01180) rpmA 246801..247058 (-) 258 WP_017805010.1 50S ribosomal protein L27 -
  HHJ56_RS01185 (HHJ56_01185) rplU 247079..247390 (-) 312 WP_035688647.1 50S ribosomal protein L21 -
  HHJ56_RS01190 (HHJ56_01190) ispB 247628..248599 (+) 972 WP_035688646.1 octaprenyl diphosphate synthase -
  HHJ56_RS01195 (HHJ56_01195) - 248624..249367 (+) 744 WP_035688645.1 epoxyqueuosine reductase QueH -
  HHJ56_RS01200 (HHJ56_01200) trxA 249740..250063 (-) 324 WP_035688643.1 thioredoxin -
  HHJ56_RS01205 (HHJ56_01205) - 250181..251176 (-) 996 WP_035688641.1 2-hydroxyacid dehydrogenase -
  HHJ56_RS01210 (HHJ56_01210) - 251194..252303 (-) 1110 WP_035688666.1 methionine biosynthesis PLP-dependent protein -
  HHJ56_RS01230 (HHJ56_01230) - 252937..254028 (-) 1092 WP_168939904.1 site-specific integrase -
  HHJ56_RS01235 (HHJ56_01235) - 254265..254861 (-) 597 WP_052716802.1 N-6 DNA methylase -
  HHJ56_RS11745 - 255102..255890 (-) 789 WP_244300904.1 antA/AntB antirepressor family protein -
  HHJ56_RS01245 (HHJ56_01245) - 255999..256499 (-) 501 WP_046097482.1 hypothetical protein -
  HHJ56_RS01250 (HHJ56_01250) - 256564..256782 (-) 219 WP_046097481.1 hypothetical protein -
  HHJ56_RS01255 (HHJ56_01255) - 256799..257038 (-) 240 WP_046097480.1 hypothetical protein -
  HHJ56_RS01260 (HHJ56_01260) - 257050..257355 (-) 306 WP_046097479.1 hypothetical protein -
  HHJ56_RS01265 (HHJ56_01265) - 257357..257701 (-) 345 WP_017807489.1 hypothetical protein -
  HHJ56_RS01270 (HHJ56_01270) - 257716..257925 (-) 210 WP_168939905.1 hypothetical protein -
  HHJ56_RS01275 (HHJ56_01275) rdgC 257922..258818 (-) 897 WP_035689252.1 recombination-associated protein RdgC -
  HHJ56_RS01280 (HHJ56_01280) - 258878..259273 (-) 396 WP_051128140.1 hypothetical protein -
  HHJ56_RS01285 (HHJ56_01285) - 259270..259587 (-) 318 WP_051128139.1 hypothetical protein -
  HHJ56_RS01290 (HHJ56_01290) ssb 259674..260153 (-) 480 WP_035689249.1 single-stranded DNA-binding protein Machinery gene
  HHJ56_RS01295 (HHJ56_01295) - 260141..260773 (-) 633 WP_046097549.1 YqaJ viral recombinase family protein -
  HHJ56_RS01300 (HHJ56_01300) bet 260770..261549 (-) 780 WP_035689246.1 phage recombination protein Bet -
  HHJ56_RS01305 (HHJ56_01305) - 261560..262786 (-) 1227 WP_233570690.1 hypothetical protein -
  HHJ56_RS01315 (HHJ56_01315) - 262716..263390 (-) 675 WP_051128138.1 hypothetical protein -
  HHJ56_RS01320 (HHJ56_01320) - 263380..263655 (-) 276 WP_035689243.1 hypothetical protein -
  HHJ56_RS01325 (HHJ56_01325) - 263677..263985 (-) 309 WP_046097548.1 hypothetical protein -
  HHJ56_RS01330 (HHJ56_01330) - 264079..264651 (-) 573 WP_168952571.1 hypothetical protein -
  HHJ56_RS01335 (HHJ56_01335) - 265324..265545 (-) 222 WP_017806446.1 hypothetical protein -
  HHJ56_RS01340 (HHJ56_01340) - 265560..265730 (+) 171 WP_017807323.1 DUF1508 domain-containing protein -
  HHJ56_RS01345 (HHJ56_01345) - 266049..266345 (+) 297 WP_136711940.1 type II toxin-antitoxin system RelE/ParE family toxin -
  HHJ56_RS01350 (HHJ56_01350) - 266346..266636 (+) 291 WP_017807324.1 addiction module antidote protein -
  HHJ56_RS01355 (HHJ56_01355) - 266783..267556 (-) 774 WP_017807325.1 DUF1828 domain-containing protein -
  HHJ56_RS01360 (HHJ56_01360) - 267558..268043 (-) 486 WP_017807326.1 hypothetical protein -
  HHJ56_RS01365 (HHJ56_01365) - 268043..268696 (-) 654 WP_017807327.1 LexA family transcriptional regulator -
  HHJ56_RS01370 (HHJ56_01370) - 268834..269040 (+) 207 WP_017807328.1 helix-turn-helix transcriptional regulator -
  HHJ56_RS01375 (HHJ56_01375) - 269088..269528 (+) 441 Protein_267 YmfL family putative regulatory protein -
  HHJ56_RS01380 (HHJ56_01380) - 269546..269953 (-) 408 WP_168939907.1 hypothetical protein -
  HHJ56_RS01385 (HHJ56_01385) - 270063..270833 (+) 771 WP_046097539.1 phage regulatory protein/antirepressor Ant -
  HHJ56_RS01390 (HHJ56_01390) - 270830..271636 (+) 807 WP_035689420.1 helix-turn-helix domain-containing protein -
  HHJ56_RS01395 (HHJ56_01395) - 271633..272316 (+) 684 WP_017807330.1 replication protein P -
  HHJ56_RS01400 (HHJ56_01400) - 272425..273060 (+) 636 WP_052716788.1 DUF1367 family protein -
  HHJ56_RS01405 (HHJ56_01405) - 273061..273345 (+) 285 WP_035689367.1 DUF1364 domain-containing protein -
  HHJ56_RS11695 - 273342..273674 (+) 333 WP_051128145.1 HNH endonuclease -
  HHJ56_RS01415 (HHJ56_01415) - 273671..274021 (+) 351 WP_035689370.1 RusA family crossover junction endodeoxyribonuclease -
  HHJ56_RS01420 (HHJ56_01420) - 274021..274383 (+) 363 WP_035689371.1 antiterminator Q family protein -
  HHJ56_RS01425 (HHJ56_01425) - 274628..275632 (+) 1005 WP_035689374.1 hypothetical protein -
  HHJ56_RS01430 (HHJ56_01430) - 275930..276100 (-) 171 WP_017807323.1 DUF1508 domain-containing protein -
  HHJ56_RS01435 (HHJ56_01435) - 276115..276336 (+) 222 WP_017806446.1 hypothetical protein -
  HHJ56_RS01440 (HHJ56_01440) - 276593..276910 (+) 318 WP_035660437.1 hypothetical protein -
  HHJ56_RS01445 (HHJ56_01445) - 276914..277171 (+) 258 WP_017807508.1 hypothetical protein -
  HHJ56_RS01450 (HHJ56_01450) - 277152..277859 (+) 708 WP_051128146.1 HNH endonuclease signature motif containing protein -
  HHJ56_RS01460 (HHJ56_01460) - 278092..279057 (+) 966 WP_046097210.1 site-specific integrase -
  HHJ56_RS01465 (HHJ56_01465) - 279057..279719 (+) 663 WP_035688039.1 N-6 DNA methylase -
  HHJ56_RS01470 (HHJ56_01470) - 279869..280102 (+) 234 WP_035688041.1 hypothetical protein -
  HHJ56_RS01475 (HHJ56_01475) - 280250..281227 (-) 978 WP_035688045.1 P63C domain-containing protein -
  HHJ56_RS01480 (HHJ56_01480) - 281394..282191 (+) 798 WP_035688046.1 hypothetical protein -
  HHJ56_RS01485 (HHJ56_01485) - 282293..282553 (+) 261 WP_021723952.1 hypothetical protein -
  HHJ56_RS11750 - 282803..283426 (+) 624 WP_046097212.1 BRO family protein -
  HHJ56_RS01495 (HHJ56_01495) - 283519..283857 (+) 339 WP_035688048.1 hypothetical protein -
  HHJ56_RS01500 (HHJ56_01500) - 284076..284342 (+) 267 WP_046097213.1 hypothetical protein -
  HHJ56_RS01505 (HHJ56_01505) - 284332..285279 (+) 948 WP_035688050.1 hypothetical protein -
  HHJ56_RS01510 (HHJ56_01510) - 285289..285564 (+) 276 WP_046097214.1 hypothetical protein -
  HHJ56_RS01515 (HHJ56_01515) - 285554..285709 (+) 156 WP_156127741.1 hypothetical protein -
  HHJ56_RS01520 (HHJ56_01520) - 285706..285930 (+) 225 WP_035688051.1 hypothetical protein -
  HHJ56_RS01525 (HHJ56_01525) - 285927..286427 (+) 501 WP_035688053.1 siphovirus Gp157 family protein -
  HHJ56_RS01530 (HHJ56_01530) - 286438..287325 (+) 888 WP_035688055.1 ATP-binding protein -
  HHJ56_RS01535 (HHJ56_01535) ssb 287325..287804 (+) 480 WP_035688057.1 single-stranded DNA-binding protein Machinery gene
  HHJ56_RS01540 (HHJ56_01540) - 287813..288061 (+) 249 WP_035688059.1 hypothetical protein -
  HHJ56_RS01545 (HHJ56_01545) - 288104..288418 (+) 315 WP_035688062.1 hypothetical protein -
  HHJ56_RS01550 (HHJ56_01550) - 288441..288623 (-) 183 WP_035688065.1 ribbon-helix-helix protein, CopG family -
  HHJ56_RS01555 (HHJ56_01555) - 288933..289142 (-) 210 WP_035688068.1 hypothetical protein -
  HHJ56_RS01560 (HHJ56_01560) - 289657..290319 (+) 663 WP_035688071.1 P22AR C-terminal domain-containing protein -
  HHJ56_RS01565 (HHJ56_01565) - 290563..291159 (+) 597 WP_051128099.1 N-6 DNA methylase -
  HHJ56_RS11755 - 291190..291513 (+) 324 WP_081637542.1 helix-turn-helix domain-containing protein -
  HHJ56_RS01570 (HHJ56_01570) - 291426..292406 (+) 981 WP_233570723.1 site-specific integrase -

Sequence


Protein


Download         Length: 159 a.a.        Molecular weight: 17869.72 Da        Isoelectric Point: 5.9430

>NTDB_id=440164 HHJ56_RS01290 WP_035689249.1 259674..260153(-) (ssb) [Avibacterium paragallinarum strain ADL-AP01]
MAGINKAIIVGNLGNDPEIRTMQNGDQVATISVATSESWTDKQTGERRELTEWHRIVLYRRLAEIAGQYLKKGSKVYVEG
RIRTRKWQDQQGIERYTTEIQGDVLQMLDSRQDGQGAQTNAPPRQTQSTKSNAYANAKNGNYTPPAQNNGDELDDDIPF

Nucleotide


Download         Length: 480 bp        

>NTDB_id=440164 HHJ56_RS01290 WP_035689249.1 259674..260153(-) (ssb) [Avibacterium paragallinarum strain ADL-AP01]
ATGGCAGGCATAAACAAAGCCATCATCGTCGGCAATTTAGGCAACGATCCAGAAATCCGCACAATGCAAAATGGCGATCA
GGTTGCAACAATCAGCGTGGCGACATCAGAAAGCTGGACGGATAAACAAACAGGCGAACGGCGAGAACTCACCGAATGGC
ACAGAATTGTACTTTATCGGCGGTTAGCGGAAATTGCAGGGCAATACCTCAAAAAAGGCTCAAAAGTTTATGTGGAAGGT
CGTATCAGAACCAGAAAATGGCAAGATCAACAAGGCATTGAGCGTTACACCACCGAAATTCAAGGCGATGTATTGCAAAT
GCTAGACAGTCGCCAAGATGGACAAGGTGCGCAAACAAACGCACCACCACGTCAAACGCAATCAACAAAATCCAATGCTT
ATGCCAACGCTAAAAACGGCAACTACACGCCACCAGCGCAGAATAATGGTGATGAGCTAGATGATGATATTCCGTTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

63.333

100

0.717

  ssb Vibrio cholerae strain A1552

46.328

100

0.516

  ssb Neisseria meningitidis MC58

44.509

100

0.484

  ssb Neisseria gonorrhoeae MS11

42.775

100

0.465