Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   HHJ58_RS06720 Genome accession   NZ_CP051640
Coordinates   1455524..1456003 (-) Length   159 a.a.
NCBI ID   WP_035688057.1    Uniprot ID   -
Organism   Avibacterium paragallinarum strain ADL-AP07     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1450922..1498939 1455524..1456003 within 0


Gene organization within MGE regions


Location: 1450922..1498939
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HHJ58_RS06685 (HHJ58_06685) - 1450922..1451929 (-) 1008 WP_244300938.1 site-specific integrase -
  HHJ58_RS11775 - 1451815..1452138 (-) 324 WP_081637542.1 helix-turn-helix domain-containing protein -
  HHJ58_RS06690 (HHJ58_06690) - 1452169..1452765 (-) 597 WP_051128099.1 N-6 DNA methylase -
  HHJ58_RS06695 (HHJ58_06695) - 1453009..1453671 (-) 663 WP_035688071.1 P22AR C-terminal domain-containing protein -
  HHJ58_RS06700 (HHJ58_06700) - 1454186..1454395 (+) 210 WP_035688068.1 hypothetical protein -
  HHJ58_RS06705 (HHJ58_06705) - 1454705..1454887 (+) 183 WP_035688065.1 ribbon-helix-helix protein, CopG family -
  HHJ58_RS06710 (HHJ58_06710) - 1454910..1455224 (-) 315 WP_035688062.1 hypothetical protein -
  HHJ58_RS06715 (HHJ58_06715) - 1455267..1455515 (-) 249 WP_035688059.1 hypothetical protein -
  HHJ58_RS06720 (HHJ58_06720) ssb 1455524..1456003 (-) 480 WP_035688057.1 single-stranded DNA-binding protein Machinery gene
  HHJ58_RS06725 (HHJ58_06725) - 1456003..1456890 (-) 888 WP_035688055.1 ATP-binding protein -
  HHJ58_RS06730 (HHJ58_06730) - 1456901..1457401 (-) 501 WP_035688053.1 siphovirus Gp157 family protein -
  HHJ58_RS06735 (HHJ58_06735) - 1457398..1457622 (-) 225 WP_035688051.1 hypothetical protein -
  HHJ58_RS06740 (HHJ58_06740) - 1457619..1457774 (-) 156 WP_156127741.1 hypothetical protein -
  HHJ58_RS06745 (HHJ58_06745) - 1457764..1458039 (-) 276 WP_046097214.1 hypothetical protein -
  HHJ58_RS06750 (HHJ58_06750) - 1458049..1458996 (-) 948 WP_035688050.1 hypothetical protein -
  HHJ58_RS06755 (HHJ58_06755) - 1458986..1459252 (-) 267 WP_046097213.1 hypothetical protein -
  HHJ58_RS06760 (HHJ58_06760) - 1459471..1459809 (-) 339 WP_035688048.1 hypothetical protein -
  HHJ58_RS11780 - 1459902..1460525 (-) 624 WP_046097212.1 BRO family protein -
  HHJ58_RS06770 (HHJ58_06770) - 1460775..1461035 (-) 261 WP_021723952.1 hypothetical protein -
  HHJ58_RS06775 (HHJ58_06775) - 1461137..1461934 (-) 798 WP_035688046.1 hypothetical protein -
  HHJ58_RS06780 (HHJ58_06780) - 1462101..1463078 (+) 978 WP_035688045.1 P63C domain-containing protein -
  HHJ58_RS06785 (HHJ58_06785) - 1463226..1463459 (-) 234 WP_035688041.1 hypothetical protein -
  HHJ58_RS06790 (HHJ58_06790) - 1463609..1464271 (-) 663 WP_035688039.1 N-6 DNA methylase -
  HHJ58_RS06795 (HHJ58_06795) - 1464271..1465236 (-) 966 WP_046097210.1 site-specific integrase -
  HHJ58_RS06805 (HHJ58_06805) - 1465469..1466176 (-) 708 WP_051128146.1 HNH endonuclease signature motif containing protein -
  HHJ58_RS06810 (HHJ58_06810) - 1466157..1466414 (-) 258 WP_017807508.1 hypothetical protein -
  HHJ58_RS06815 (HHJ58_06815) - 1466418..1466735 (-) 318 WP_035660437.1 hypothetical protein -
  HHJ58_RS06820 (HHJ58_06820) - 1466992..1467213 (-) 222 WP_017806446.1 hypothetical protein -
  HHJ58_RS06825 (HHJ58_06825) - 1467228..1467398 (+) 171 WP_017807323.1 DUF1508 domain-containing protein -
  HHJ58_RS06830 (HHJ58_06830) - 1467697..1468701 (-) 1005 WP_035689374.1 hypothetical protein -
  HHJ58_RS06835 (HHJ58_06835) - 1468946..1469308 (-) 363 WP_035689371.1 antiterminator Q family protein -
  HHJ58_RS06840 (HHJ58_06840) - 1469308..1469658 (-) 351 WP_035689370.1 RusA family crossover junction endodeoxyribonuclease -
  HHJ58_RS11705 - 1469655..1469987 (-) 333 WP_051128145.1 HNH endonuclease -
  HHJ58_RS06850 (HHJ58_06850) - 1469984..1470268 (-) 285 WP_035689367.1 DUF1364 domain-containing protein -
  HHJ58_RS06855 (HHJ58_06855) - 1470269..1470904 (-) 636 WP_052716788.1 DUF1367 family protein -
  HHJ58_RS06860 (HHJ58_06860) - 1471013..1471696 (-) 684 WP_017807330.1 replication protein P -
  HHJ58_RS06865 (HHJ58_06865) - 1471693..1472499 (-) 807 WP_035689420.1 helix-turn-helix domain-containing protein -
  HHJ58_RS06870 (HHJ58_06870) - 1472496..1473266 (-) 771 WP_046097539.1 phage regulatory protein/antirepressor Ant -
  HHJ58_RS06875 (HHJ58_06875) - 1473376..1473783 (+) 408 WP_168939907.1 hypothetical protein -
  HHJ58_RS06880 (HHJ58_06880) - 1473801..1474241 (-) 441 Protein_1336 YmfL family putative regulatory protein -
  HHJ58_RS06885 (HHJ58_06885) - 1474289..1474495 (-) 207 WP_017807328.1 helix-turn-helix transcriptional regulator -
  HHJ58_RS06890 (HHJ58_06890) - 1474633..1475286 (+) 654 WP_017807327.1 LexA family transcriptional regulator -
  HHJ58_RS06895 (HHJ58_06895) - 1475286..1475771 (+) 486 WP_017807326.1 hypothetical protein -
  HHJ58_RS06900 (HHJ58_06900) - 1475773..1476546 (+) 774 WP_017807325.1 DUF1828 domain-containing protein -
  HHJ58_RS06905 (HHJ58_06905) - 1476693..1476983 (-) 291 WP_017807324.1 addiction module antidote protein -
  HHJ58_RS06910 (HHJ58_06910) - 1476984..1477280 (-) 297 WP_136711940.1 type II toxin-antitoxin system RelE/ParE family toxin -
  HHJ58_RS06915 (HHJ58_06915) - 1477599..1477769 (-) 171 WP_017807323.1 DUF1508 domain-containing protein -
  HHJ58_RS06920 (HHJ58_06920) - 1477784..1478005 (+) 222 WP_017806446.1 hypothetical protein -
  HHJ58_RS06925 (HHJ58_06925) - 1478705..1479319 (+) 615 WP_168939992.1 polymer-forming cytoskeletal protein -
  HHJ58_RS06930 (HHJ58_06930) - 1479413..1479721 (+) 309 WP_046097548.1 hypothetical protein -
  HHJ58_RS06935 (HHJ58_06935) - 1479743..1480018 (+) 276 WP_035689243.1 hypothetical protein -
  HHJ58_RS06940 (HHJ58_06940) - 1480008..1480469 (+) 462 WP_168939987.1 hypothetical protein -
  HHJ58_RS06945 (HHJ58_06945) - 1480466..1480681 (+) 216 WP_168939988.1 hypothetical protein -
  HHJ58_RS06955 (HHJ58_06955) - 1480611..1481837 (+) 1227 WP_233570690.1 hypothetical protein -
  HHJ58_RS06960 (HHJ58_06960) bet 1481848..1482626 (+) 779 Protein_1351 phage recombination protein Bet -
  HHJ58_RS06965 (HHJ58_06965) - 1482623..1483256 (+) 634 Protein_1352 YqaJ viral recombinase family protein -
  HHJ58_RS06970 (HHJ58_06970) ssb 1483244..1483723 (+) 480 WP_035689249.1 single-stranded DNA-binding protein Machinery gene
  HHJ58_RS06975 (HHJ58_06975) - 1483887..1484126 (+) 240 WP_168939989.1 hypothetical protein -
  HHJ58_RS06980 (HHJ58_06980) - 1484123..1484518 (+) 396 WP_051128140.1 hypothetical protein -
  HHJ58_RS06985 (HHJ58_06985) rdgC 1484578..1485472 (+) 895 Protein_1356 recombination-associated protein RdgC -
  HHJ58_RS06990 (HHJ58_06990) - 1485469..1485678 (+) 210 WP_035689255.1 hypothetical protein -
  HHJ58_RS06995 (HHJ58_06995) - 1485694..1485891 (+) 198 WP_017807560.1 hypothetical protein -
  HHJ58_RS07000 (HHJ58_07000) - 1485894..1486223 (+) 330 WP_035689257.1 hypothetical protein -
  HHJ58_RS07005 (HHJ58_07005) - 1486339..1486842 (+) 504 WP_051128141.1 hypothetical protein -
  HHJ58_RS07010 (HHJ58_07010) - 1486835..1487068 (+) 234 WP_035689260.1 hypothetical protein -
  HHJ58_RS07015 (HHJ58_07015) - 1487144..1487428 (+) 285 WP_035689262.1 hypothetical protein -
  HHJ58_RS07020 (HHJ58_07020) - 1487495..1487977 (+) 483 WP_035689265.1 methyltransferase -
  HHJ58_RS07025 (HHJ58_07025) - 1487994..1488590 (+) 597 WP_052716794.1 N-6 DNA methylase -
  HHJ58_RS07030 (HHJ58_07030) - 1488610..1489998 (+) 1389 WP_035689148.1 DNA cytosine methyltransferase -
  HHJ58_RS07035 (HHJ58_07035) - 1490032..1490895 (+) 864 WP_035689146.1 SPFH domain-containing protein -
  HHJ58_RS07040 (HHJ58_07040) - 1490895..1491050 (+) 156 WP_156127763.1 hypothetical protein -
  HHJ58_RS07045 (HHJ58_07045) - 1491193..1491372 (+) 180 WP_017806764.1 AlpA family transcriptional regulator -
  HHJ58_RS07050 (HHJ58_07050) - 1491568..1492275 (-) 708 WP_035689144.1 YwiC-like family protein -
  HHJ58_RS07055 (HHJ58_07055) - 1492468..1492818 (+) 351 WP_035689137.1 RidA family protein -
  HHJ58_RS07060 (HHJ58_07060) - 1492855..1493718 (-) 864 WP_035689134.1 endonuclease/exonuclease/phosphatase family protein -
  HHJ58_RS07065 (HHJ58_07065) - 1493873..1495189 (+) 1317 WP_017806769.1 sodium:proton antiporter -
  HHJ58_RS07070 (HHJ58_07070) - 1495378..1496805 (-) 1428 WP_168939941.1 HlyD family type I secretion periplasmic adaptor subunit -

Sequence


Protein


Download         Length: 159 a.a.        Molecular weight: 17826.62 Da        Isoelectric Point: 6.4810

>NTDB_id=440117 HHJ58_RS06720 WP_035688057.1 1455524..1456003(-) (ssb) [Avibacterium paragallinarum strain ADL-AP07]
MAGINKAIIVGNLGNDPEIRTMQNGDQVATISVATSESWTDKQTGERRELTEWHRIVFYRRQAEIAGQYLHKGSKVYVEG
RIRTRKWQDQQGIERYTTEIQGDVLQMLDSRQDGQGAQTNAPPRQTQSTKSNAYANAKNGNYTPPVQGGNDGLDDDIPF

Nucleotide


Download         Length: 480 bp        

>NTDB_id=440117 HHJ58_RS06720 WP_035688057.1 1455524..1456003(-) (ssb) [Avibacterium paragallinarum strain ADL-AP07]
ATGGCAGGCATAAACAAAGCCATCATCGTCGGCAATTTAGGCAACGATCCAGAAATCCGCACAATGCAAAATGGCGATCA
GGTTGCAACAATCAGCGTGGCAACCTCAGAAAGCTGGACTGATAAGCAAACAGGCGAACGGCGAGAACTCACTGAATGGC
ATCGCATTGTTTTTTACCGCAGACAAGCAGAAATTGCAGGGCAATACTTGCATAAAGGCTCAAAAGTGTATGTTGAAGGA
CGTATCAGAACCAGAAAATGGCAAGATCAACAAGGCATTGAGCGTTACACCACTGAAATTCAAGGCGATGTATTGCAAAT
GCTAGACAGTCGCCAAGATGGACAAGGTGCGCAAACAAACGCACCACCACGTCAAACGCAATCGACAAAATCCAATGCTT
ATGCTAACGCCAAAAACGGTAACTACACACCACCAGTGCAGGGTGGTAATGATGGATTAGATGATGATATTCCATTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

63.889

100

0.723

  ssb Vibrio cholerae strain A1552

45.506

100

0.509

  ssb Neisseria meningitidis MC58

42.775

100

0.465

  ssb Neisseria gonorrhoeae MS11

41.04

100

0.447