Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HG575_RS00205 Genome accession   NZ_CP051540
Coordinates   37577..37690 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain LIM-002     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 32577..42690
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG575_RS00180 (HG575_00180) - 32630..34855 (+) 2226 WP_202248340.1 ATP-dependent Clp protease ATP-binding subunit -
  HG575_RS00185 (HG575_00185) panD 34845..35198 (+) 354 WP_202248342.1 aspartate 1-decarboxylase -
  HG575_RS00190 (HG575_00190) - 35201..35503 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  HG575_RS00195 (HG575_00195) - 35503..36498 (+) 996 WP_202249206.1 PDZ domain-containing protein -
  HG575_RS00200 (HG575_00200) comB6 36506..37561 (+) 1056 WP_202249204.1 P-type conjugative transfer protein TrbL Machinery gene
  HG575_RS00205 (HG575_00205) comB7 37577..37690 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HG575_RS00210 (HG575_00210) comB8 37687..38430 (+) 744 WP_202248344.1 virB8 family protein Machinery gene
  HG575_RS00215 (HG575_00215) comB9 38430..39413 (+) 984 WP_202248346.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG575_RS00220 (HG575_00220) comB10 39406..40542 (+) 1137 WP_202248348.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG575_RS00225 (HG575_00225) - 40612..42024 (+) 1413 WP_202248350.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=439655 HG575_RS00205 WP_001217873.1 37577..37690(+) (comB7) [Helicobacter pylori strain LIM-002]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=439655 HG575_RS00205 WP_001217873.1 37577..37690(+) (comB7) [Helicobacter pylori strain LIM-002]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1