Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HG582_RS00200 Genome accession   NZ_CP051534
Coordinates   37008..37121 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain LIM-009     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 32008..42121
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG582_RS00175 (HG582_00175) - 32052..34277 (+) 2226 WP_202143931.1 ATP-dependent Clp protease ATP-binding subunit -
  HG582_RS00180 (HG582_00180) panD 34267..34620 (+) 354 WP_000142252.1 aspartate 1-decarboxylase -
  HG582_RS00185 (HG582_00185) - 34623..34925 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  HG582_RS00190 (HG582_00190) - 34925..35929 (+) 1005 WP_202143932.1 PDZ domain-containing protein -
  HG582_RS00195 (HG582_00195) comB6 35937..36992 (+) 1056 WP_202144352.1 P-type conjugative transfer protein TrbL Machinery gene
  HG582_RS00200 (HG582_00200) comB7 37008..37121 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HG582_RS00205 (HG582_00205) comB8 37118..37861 (+) 744 WP_202143933.1 virB8 family protein Machinery gene
  HG582_RS00210 (HG582_00210) comB9 37861..38850 (+) 990 WP_202143934.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG582_RS00215 (HG582_00215) comB10 38843..39973 (+) 1131 WP_202143935.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG582_RS00220 (HG582_00220) - 40044..41462 (+) 1419 WP_202143936.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=439553 HG582_RS00200 WP_001217873.1 37008..37121(+) (comB7) [Helicobacter pylori strain LIM-009]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=439553 HG582_RS00200 WP_001217873.1 37008..37121(+) (comB7) [Helicobacter pylori strain LIM-009]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1