Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HG583_RS00200 Genome accession   NZ_CP051533
Coordinates   37614..37727 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain LIM-010     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 32614..42727
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG583_RS00175 (HG583_00175) - 32661..34886 (+) 2226 WP_202142987.1 ATP-dependent Clp protease ATP-binding subunit -
  HG583_RS00180 (HG583_00180) panD 34876..35226 (+) 351 WP_108593697.1 aspartate 1-decarboxylase -
  HG583_RS00185 (HG583_00185) - 35238..35540 (+) 303 WP_000347928.1 YbaB/EbfC family nucleoid-associated protein -
  HG583_RS00190 (HG583_00190) - 35540..36535 (+) 996 WP_202143421.1 PDZ domain-containing protein -
  HG583_RS00195 (HG583_00195) comB6 36543..37598 (+) 1056 WP_202143420.1 P-type conjugative transfer protein TrbL Machinery gene
  HG583_RS00200 (HG583_00200) comB7 37614..37727 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HG583_RS00205 (HG583_00205) comB8 37724..38461 (+) 738 WP_202142988.1 virB8 family protein Machinery gene
  HG583_RS00210 (HG583_00210) comB9 38461..39444 (+) 984 WP_202142989.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG583_RS00215 (HG583_00215) comB10 39437..40573 (+) 1137 WP_202142990.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG583_RS00220 (HG583_00220) - 40643..42055 (+) 1413 WP_202142991.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=439530 HG583_RS00200 WP_001217873.1 37614..37727(+) (comB7) [Helicobacter pylori strain LIM-010]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=439530 HG583_RS00200 WP_001217873.1 37614..37727(+) (comB7) [Helicobacter pylori strain LIM-010]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTATATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1