Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HGK51_RS00195 Genome accession   NZ_CP051511
Coordinates   33549..33662 (+) Length   37 a.a.
NCBI ID   WP_001218100.1    Uniprot ID   -
Organism   Helicobacter pylori strain ASHA-006     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 28549..38662
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HGK51_RS00170 (HGK51_00170) - 28600..30822 (+) 2223 WP_202170805.1 ATP-dependent Clp protease ATP-binding subunit -
  HGK51_RS00175 (HGK51_00175) panD 30812..31162 (+) 351 WP_000142282.1 aspartate 1-decarboxylase -
  HGK51_RS00180 (HGK51_00180) - 31173..31475 (+) 303 WP_000347918.1 YbaB/EbfC family nucleoid-associated protein -
  HGK51_RS00185 (HGK51_00185) - 31475..32470 (+) 996 WP_202171147.1 PDZ domain-containing protein -
  HGK51_RS00190 (HGK51_00190) comB6 32478..33533 (+) 1056 WP_202171146.1 P-type conjugative transfer protein TrbL Machinery gene
  HGK51_RS00195 (HGK51_00195) comB7 33549..33662 (+) 114 WP_001218100.1 hypothetical protein Machinery gene
  HGK51_RS00200 (HGK51_00200) comB8 33659..34402 (+) 744 WP_000660504.1 virB8 family protein Machinery gene
  HGK51_RS00205 (HGK51_00205) comB9 34402..35367 (+) 966 WP_202170806.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HGK51_RS00210 (HGK51_00210) comB10 35360..36496 (+) 1137 WP_202166724.1 DNA type IV secretion system protein ComB10 Machinery gene
  HGK51_RS00215 (HGK51_00215) - 36567..37979 (+) 1413 WP_202170807.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4263.19 Da        Isoelectric Point: 9.3572

>NTDB_id=439409 HGK51_RS00195 WP_001218100.1 33549..33662(+) (comB7) [Helicobacter pylori strain ASHA-006]
MRIFSVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=439409 HGK51_RS00195 WP_001218100.1 33549..33662(+) (comB7) [Helicobacter pylori strain ASHA-006]
ATGAGAATTTTTTCTGTCATTATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

89.189

100

0.892