Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HG579_RS00200 Genome accession   NZ_CP051493
Coordinates   37662..37775 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain LIM-006     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 32662..42775
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG579_RS00175 (HG579_00175) - 32715..34940 (+) 2226 WP_202133908.1 ATP-dependent Clp protease ATP-binding subunit -
  HG579_RS00180 (HG579_00180) panD 34930..35283 (+) 354 WP_000142243.1 aspartate 1-decarboxylase -
  HG579_RS00185 (HG579_00185) - 35286..35579 (+) 294 WP_000347915.1 YbaB/EbfC family nucleoid-associated protein -
  HG579_RS00190 (HG579_00190) - 35579..36583 (+) 1005 WP_202133909.1 PDZ domain-containing protein -
  HG579_RS00195 (HG579_00195) comB6 36591..37646 (+) 1056 WP_202133910.1 P-type conjugative transfer protein TrbL Machinery gene
  HG579_RS00200 (HG579_00200) comB7 37662..37775 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HG579_RS00205 (HG579_00205) comB8 37772..38515 (+) 744 WP_108374430.1 virB8 family protein Machinery gene
  HG579_RS00210 (HG579_00210) comB9 38515..39504 (+) 990 WP_202133911.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG579_RS00215 (HG579_00215) comB10 39497..40633 (+) 1137 WP_202133912.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG579_RS00220 (HG579_00220) - 40704..42119 (+) 1416 WP_202133913.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=439021 HG579_RS00200 WP_001217873.1 37662..37775(+) (comB7) [Helicobacter pylori strain LIM-006]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=439021 HG579_RS00200 WP_001217873.1 37662..37775(+) (comB7) [Helicobacter pylori strain LIM-006]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAACCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1