Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   HC658_RS12195 Genome accession   NZ_CP051466
Coordinates   2396818..2397192 (-) Length   124 a.a.
NCBI ID   WP_029726722.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain UCMB5021     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2391818..2402192
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HC658_RS12155 (HC658_23990) yqhG 2392149..2392943 (+) 795 WP_015714249.1 YqhG family protein -
  HC658_RS12160 (HC658_24000) sinI 2393126..2393299 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  HC658_RS12165 (HC658_24010) sinR 2393333..2393668 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  HC658_RS12170 (HC658_24020) tasA 2393761..2394546 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  HC658_RS12175 (HC658_24030) sipW 2394610..2395182 (-) 573 WP_072692741.1 signal peptidase I SipW -
  HC658_RS12180 (HC658_24040) tapA 2395166..2395927 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  HC658_RS12185 (HC658_24050) yqzG 2396199..2396525 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  HC658_RS12190 (HC658_24060) spoIITA 2396567..2396746 (-) 180 WP_029726723.1 YqzE family protein -
  HC658_RS12195 (HC658_24070) comGG 2396818..2397192 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  HC658_RS12200 (HC658_24080) comGF 2397193..2397576 (-) 384 WP_032722118.1 ComG operon protein ComGF Machinery gene
  HC658_RS12205 (HC658_24090) comGE 2397602..2397949 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  HC658_RS12210 (HC658_24100) comGD 2397933..2398364 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  HC658_RS12215 (HC658_24110) comGC 2398354..2398650 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  HC658_RS12220 (HC658_24120) comGB 2398664..2399701 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  HC658_RS12225 (HC658_24130) comGA 2399688..2400758 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  HC658_RS12230 (HC658_24150) - 2400971..2401168 (-) 198 WP_014480259.1 CBS domain-containing protein -
  HC658_RS12235 (HC658_24160) corA 2401170..2402123 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14443.63 Da        Isoelectric Point: 7.8383

>NTDB_id=438655 HC658_RS12195 WP_029726722.1 2396818..2397192(-) (comGG) [Bacillus subtilis subsp. subtilis strain UCMB5021]
MYCTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSVRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=438655 HC658_RS12195 WP_029726722.1 2396818..2397192(-) (comGG) [Bacillus subtilis subsp. subtilis strain UCMB5021]
ATGTATTGTACAAGAGGGTTTATTTACCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGGTCCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.161

100

0.952