Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   HC658_RS12160 Genome accession   NZ_CP051466
Coordinates   2393126..2393299 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis strain UCMB5021     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2388126..2398299
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HC658_RS12145 (HC658_23970) gcvT 2388925..2390013 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  HC658_RS12150 (HC658_23980) hepAA 2390455..2392128 (+) 1674 WP_029726726.1 SNF2-related protein -
  HC658_RS12155 (HC658_23990) yqhG 2392149..2392943 (+) 795 WP_015714249.1 YqhG family protein -
  HC658_RS12160 (HC658_24000) sinI 2393126..2393299 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  HC658_RS12165 (HC658_24010) sinR 2393333..2393668 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  HC658_RS12170 (HC658_24020) tasA 2393761..2394546 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  HC658_RS12175 (HC658_24030) sipW 2394610..2395182 (-) 573 WP_072692741.1 signal peptidase I SipW -
  HC658_RS12180 (HC658_24040) tapA 2395166..2395927 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  HC658_RS12185 (HC658_24050) yqzG 2396199..2396525 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  HC658_RS12190 (HC658_24060) spoIITA 2396567..2396746 (-) 180 WP_029726723.1 YqzE family protein -
  HC658_RS12195 (HC658_24070) comGG 2396818..2397192 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  HC658_RS12200 (HC658_24080) comGF 2397193..2397576 (-) 384 WP_032722118.1 ComG operon protein ComGF Machinery gene
  HC658_RS12205 (HC658_24090) comGE 2397602..2397949 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=438653 HC658_RS12160 WP_003230187.1 2393126..2393299(+) (sinI) [Bacillus subtilis subsp. subtilis strain UCMB5021]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=438653 HC658_RS12160 WP_003230187.1 2393126..2393299(+) (sinI) [Bacillus subtilis subsp. subtilis strain UCMB5021]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1