Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HGI45_RS00200 Genome accession   NZ_CP051292
Coordinates   37517..37630 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain ASHA-003     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32517..42630
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HGI45_RS00175 (HGI45_00175) - 32558..34786 (+) 2229 WP_202137128.1 ATP-dependent Clp protease ATP-binding subunit -
  HGI45_RS00180 (HGI45_00180) panD 34776..35129 (+) 354 WP_000142278.1 aspartate 1-decarboxylase -
  HGI45_RS00185 (HGI45_00185) - 35132..35434 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  HGI45_RS00190 (HGI45_00190) - 35434..36438 (+) 1005 WP_202137129.1 PDZ domain-containing protein -
  HGI45_RS00195 (HGI45_00195) comB6 36446..37501 (+) 1056 WP_202137130.1 P-type conjugative transfer protein TrbL Machinery gene
  HGI45_RS00200 (HGI45_00200) comB7 37517..37630 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HGI45_RS00205 (HGI45_00205) comB8 37627..38370 (+) 744 WP_202137131.1 virB8 family protein Machinery gene
  HGI45_RS00210 (HGI45_00210) comB9 38370..39356 (+) 987 WP_202137132.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HGI45_RS00215 (HGI45_00215) comB10 39349..40479 (+) 1131 WP_202137133.1 DNA type IV secretion system protein ComB10 Machinery gene
  HGI45_RS00220 (HGI45_00220) - 40549..41961 (+) 1413 WP_202137134.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=437258 HGI45_RS00200 WP_001217873.1 37517..37630(+) (comB7) [Helicobacter pylori strain ASHA-003]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=437258 HGI45_RS00200 WP_001217873.1 37517..37630(+) (comB7) [Helicobacter pylori strain ASHA-003]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1