Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   BVELS4_RS12185 Genome accession   NZ_CP050424
Coordinates   2532497..2532934 (-) Length   145 a.a.
NCBI ID   WP_043020787.1    Uniprot ID   -
Organism   Bacillus velezensis strain S4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2527497..2537934
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BVELS4_RS12135 (BVELS4_02435) sinI 2527881..2528054 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  BVELS4_RS12140 (BVELS4_02436) sinR 2528088..2528423 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BVELS4_RS12145 (BVELS4_02437) - 2528471..2529256 (-) 786 WP_007408329.1 TasA family protein -
  BVELS4_RS12150 (BVELS4_02438) - 2529321..2529905 (-) 585 WP_025284996.1 signal peptidase I -
  BVELS4_RS12155 (BVELS4_02439) tapA 2529877..2530548 (-) 672 WP_015240206.1 amyloid fiber anchoring/assembly protein TapA -
  BVELS4_RS12160 (BVELS4_02440) - 2530807..2531136 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BVELS4_RS12165 (BVELS4_02441) - 2531176..2531355 (-) 180 WP_003153093.1 YqzE family protein -
  BVELS4_RS12170 (BVELS4_02442) comGG 2531412..2531789 (-) 378 WP_167340753.1 competence type IV pilus minor pilin ComGG Machinery gene
  BVELS4_RS12175 (BVELS4_02443) comGF 2531790..2532290 (-) 501 WP_257720329.1 competence type IV pilus minor pilin ComGF -
  BVELS4_RS12180 (BVELS4_02444) comGE 2532199..2532513 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  BVELS4_RS12185 (BVELS4_02445) comGD 2532497..2532934 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  BVELS4_RS12190 (BVELS4_02446) comGC 2532924..2533190 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  BVELS4_RS12195 (BVELS4_02447) comGB 2533237..2534274 (-) 1038 WP_015240211.1 competence type IV pilus assembly protein ComGB Machinery gene
  BVELS4_RS12200 (BVELS4_02448) comGA 2534261..2535331 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  BVELS4_RS12205 (BVELS4_02449) - 2535523..2536473 (-) 951 WP_032870601.1 magnesium transporter CorA family protein -
  BVELS4_RS12210 (BVELS4_02450) - 2536619..2537922 (+) 1304 Protein_2364 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16271.77 Da        Isoelectric Point: 10.2475

>NTDB_id=432567 BVELS4_RS12185 WP_043020787.1 2532497..2532934(-) (comGD) [Bacillus velezensis strain S4]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTELLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=432567 BVELS4_RS12185 WP_043020787.1 2532497..2532934(-) (comGD) [Bacillus velezensis strain S4]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACTGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTTCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566