Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BVELS4_RS12135 | Genome accession | NZ_CP050424 |
| Coordinates | 2527881..2528054 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain S4 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2522881..2533054
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BVELS4_RS12120 (BVELS4_02432) | gcvT | 2523694..2524794 (-) | 1101 | WP_025284994.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BVELS4_RS12125 (BVELS4_02433) | - | 2525218..2526888 (+) | 1671 | WP_108655005.1 | SNF2-related protein | - |
| BVELS4_RS12130 (BVELS4_02434) | - | 2526910..2527704 (+) | 795 | WP_015240204.1 | YqhG family protein | - |
| BVELS4_RS12135 (BVELS4_02435) | sinI | 2527881..2528054 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| BVELS4_RS12140 (BVELS4_02436) | sinR | 2528088..2528423 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BVELS4_RS12145 (BVELS4_02437) | - | 2528471..2529256 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| BVELS4_RS12150 (BVELS4_02438) | - | 2529321..2529905 (-) | 585 | WP_025284996.1 | signal peptidase I | - |
| BVELS4_RS12155 (BVELS4_02439) | tapA | 2529877..2530548 (-) | 672 | WP_015240206.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BVELS4_RS12160 (BVELS4_02440) | - | 2530807..2531136 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| BVELS4_RS12165 (BVELS4_02441) | - | 2531176..2531355 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BVELS4_RS12170 (BVELS4_02442) | comGG | 2531412..2531789 (-) | 378 | WP_167340753.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BVELS4_RS12175 (BVELS4_02443) | comGF | 2531790..2532290 (-) | 501 | WP_257720329.1 | competence type IV pilus minor pilin ComGF | - |
| BVELS4_RS12180 (BVELS4_02444) | comGE | 2532199..2532513 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| BVELS4_RS12185 (BVELS4_02445) | comGD | 2532497..2532934 (-) | 438 | WP_043020787.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=432564 BVELS4_RS12135 WP_003153105.1 2527881..2528054(+) (sinI) [Bacillus velezensis strain S4]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=432564 BVELS4_RS12135 WP_003153105.1 2527881..2528054(+) (sinI) [Bacillus velezensis strain S4]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |