Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   HBA47_RS04040 Genome accession   NZ_CP050136
Coordinates   745697..746146 (+) Length   149 a.a.
NCBI ID   WP_026036319.1    Uniprot ID   -
Organism   Kingella kingae strain ATCC 23332     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 712721..748670 745697..746146 within 0


Gene organization within MGE regions


Location: 712721..748670
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HBA47_RS03840 (HBA47_03850) - 713784..714122 (+) 339 WP_019390140.1 hypothetical protein -
  HBA47_RS03845 (HBA47_03855) - 714173..714412 (+) 240 WP_154700265.1 hypothetical protein -
  HBA47_RS03850 (HBA47_03860) - 714531..715301 (+) 771 WP_154700264.1 DNA adenine methylase -
  HBA47_RS03855 (HBA47_03865) - 715529..716803 (-) 1275 WP_003786505.1 M23 family metallopeptidase -
  HBA47_RS03860 (HBA47_03870) - 716918..717838 (+) 921 WP_100215676.1 hypothetical protein -
  HBA47_RS03865 (HBA47_03875) - 717930..718496 (-) 567 WP_060536953.1 ISAs1 family transposase -
  HBA47_RS03870 (HBA47_03880) - 718524..718772 (-) 249 WP_230311313.1 transposase family protein -
  HBA47_RS10890 (HBA47_03885) - 718911..719393 (-) 483 WP_060537125.1 IS5/IS1182 family transposase -
  HBA47_RS10895 (HBA47_03890) - 719411..719674 (-) 264 WP_154700263.1 transposase -
  HBA47_RS03880 (HBA47_03895) - 719911..721524 (+) 1614 WP_019390144.1 phosphoethanolamine transferase -
  HBA47_RS03885 (HBA47_03900) - 721605..722573 (-) 969 WP_019390145.1 KpsF/GutQ family sugar-phosphate isomerase -
  HBA47_RS11120 - 723009..723263 (-) 255 WP_230311312.1 hypothetical protein -
  HBA47_RS11125 - 723295..723438 (-) 144 WP_230311311.1 hypothetical protein -
  HBA47_RS03895 (HBA47_03910) - 723435..723908 (-) 474 WP_019390147.1 DUF4376 domain-containing protein -
  HBA47_RS03900 (HBA47_03915) - 724260..724742 (-) 483 WP_019390149.1 phage virion morphogenesis protein -
  HBA47_RS03905 (HBA47_03920) - 724739..725650 (-) 912 WP_060537124.1 phage minor head protein -
  HBA47_RS03910 (HBA47_03925) - 725650..727044 (-) 1395 WP_230311310.1 DUF935 family protein -
  HBA47_RS03915 (HBA47_03930) - 727012..727446 (+) 435 WP_019390151.1 phage major tail tube protein -
  HBA47_RS03920 (HBA47_03935) - 727580..727870 (+) 291 WP_003786198.1 phage tail assembly protein -
  HBA47_RS03925 (HBA47_03940) - 727905..728039 (+) 135 WP_038331510.1 GpE family phage tail protein -
  HBA47_RS03930 (HBA47_03945) - 728052..728210 (-) 159 WP_154700262.1 hypothetical protein -
  HBA47_RS03935 (HBA47_03950) - 728324..728890 (-) 567 WP_060536953.1 ISAs1 family transposase -
  HBA47_RS03940 (HBA47_03955) - 728918..729166 (-) 249 WP_230311240.1 transposase family protein -
  HBA47_RS03945 (HBA47_03960) - 729223..729366 (+) 144 WP_230311309.1 hypothetical protein -
  HBA47_RS03950 (HBA47_03965) - 729937..731034 (-) 1098 WP_154700272.1 phage tail protein -
  HBA47_RS11130 - 731032..731217 (-) 186 Protein_767 hypothetical protein -
  HBA47_RS03955 (HBA47_03970) - 731316..731891 (-) 576 WP_166503130.1 YmfQ family protein -
  HBA47_RS03960 (HBA47_03975) - 731897..732952 (-) 1056 WP_154699912.1 baseplate J/gp47 family protein -
  HBA47_RS03965 (HBA47_03980) - 732988..733335 (-) 348 WP_154700107.1 phage GP46 family protein -
  HBA47_RS03970 (HBA47_03985) - 733588..734208 (-) 621 WP_032133701.1 phage baseplate assembly protein V -
  HBA47_RS03975 (HBA47_03990) - 734302..735432 (-) 1131 WP_019390158.1 phage baseplate assembly protein -
  HBA47_RS03980 (HBA47_03995) - 735459..736046 (-) 588 WP_154700261.1 hypothetical protein -
  HBA47_RS03985 (HBA47_04000) - 736404..739745 (+) 3342 WP_060537120.1 Ig-like domain-containing protein -
  HBA47_RS03990 (HBA47_04005) - 739939..740439 (-) 501 WP_019389893.1 transglycosylase SLT domain-containing protein -
  HBA47_RS03995 (HBA47_04010) - 740767..741018 (-) 252 WP_019389894.1 helix-turn-helix domain-containing protein -
  HBA47_RS04000 (HBA47_04015) - 741082..741366 (-) 285 WP_019389895.1 CII family transcriptional regulator -
  HBA47_RS04005 (HBA47_04020) - 741481..742047 (-) 567 WP_060536953.1 ISAs1 family transposase -
  HBA47_RS04010 (HBA47_04025) - 742075..742323 (-) 249 WP_230311308.1 transposase family protein -
  HBA47_RS04015 (HBA47_04030) - 742366..743055 (+) 690 WP_154700260.1 YqaJ viral recombinase family protein -
  HBA47_RS04020 (HBA47_04035) - 743118..743726 (-) 609 WP_019389897.1 KilA-N domain-containing protein -
  HBA47_RS04025 (HBA47_04040) - 744036..744359 (-) 324 WP_154700259.1 DUF2335 domain-containing protein -
  HBA47_RS04030 (HBA47_04045) - 744384..744524 (-) 141 WP_154700258.1 hypothetical protein -
  HBA47_RS04035 (HBA47_04050) recT 744736..745407 (+) 672 WP_243755368.1 recombination protein RecT -
  HBA47_RS11135 - 745364..745690 (+) 327 WP_243755370.1 hypothetical protein -
  HBA47_RS04040 (HBA47_04055) ssb 745697..746146 (+) 450 WP_026036319.1 single-stranded DNA-binding protein Machinery gene
  HBA47_RS04045 (HBA47_04060) - 746208..747161 (+) 954 WP_019389901.1 hypothetical protein -
  HBA47_RS04050 (HBA47_04065) - 747175..747336 (+) 162 WP_019389902.1 hypothetical protein -
  HBA47_RS04055 (HBA47_04070) - 747343..747636 (+) 294 WP_019389903.1 hypothetical protein -
  HBA47_RS04060 (HBA47_04075) - 747657..748370 (-) 714 WP_230311307.1 site-specific integrase -
  HBA47_RS11140 - 748377..748670 (-) 294 WP_230311306.1 hypothetical protein -

Sequence


Protein


Download         Length: 149 a.a.        Molecular weight: 16586.95 Da        Isoelectric Point: 7.8071

>NTDB_id=430287 HBA47_RS04040 WP_026036319.1 745697..746146(+) (ssb) [Kingella kingae strain ATCC 23332]
MMLNKAILIGRLGKDPELRYMLQGDAVCNFSVATSESWKDQQGIKQERTEWHNITMYRKTAEIAGQYLRKGSLVYLEGKI
QTNKYVGKDGVERTAYNIVCDIMKMLGSKDDNAPTAQPAQTAPIAPPTQKQPANAPVAPQENIDSDIPF

Nucleotide


Download         Length: 450 bp        

>NTDB_id=430287 HBA47_RS04040 WP_026036319.1 745697..746146(+) (ssb) [Kingella kingae strain ATCC 23332]
ATCATGCTAAACAAAGCCATCTTAATCGGACGATTGGGCAAAGACCCCGAACTGCGCTATATGCTACAAGGCGATGCCGT
ATGTAATTTCAGCGTTGCCACTTCTGAAAGCTGGAAAGACCAGCAAGGAATTAAGCAAGAGCGCACCGAATGGCACAACA
TCACGATGTATCGCAAAACCGCCGAAATCGCAGGGCAATATTTGCGAAAAGGCAGCCTAGTTTACTTGGAAGGCAAAATC
CAAACCAACAAATACGTTGGCAAAGACGGCGTGGAACGCACCGCATACAACATCGTGTGCGACATCATGAAAATGCTAGG
CAGCAAAGACGATAACGCACCAACCGCGCAGCCAGCGCAAACTGCGCCCATTGCACCGCCAACGCAAAAGCAGCCTGCAA
ATGCGCCAGTCGCACCGCAAGAAAATATTGACAGCGACATTCCGTTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Neisseria meningitidis MC58

58.757

100

0.698

  ssb Neisseria gonorrhoeae MS11

58.757

100

0.698

  ssb Vibrio cholerae strain A1552

42.775

100

0.497

  ssb Glaesserella parasuis strain SC1401

41.243

100

0.49