Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   G7048_RS19125 Genome accession   NZ_CP049905
Coordinates   4186042..4186539 (-) Length   165 a.a.
NCBI ID   WP_166069666.1    Uniprot ID   A0A6G8C0D9
Organism   Diaphorobacter sp. HDW4B     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 4184196..4226949 4186042..4186539 within 0


Gene organization within MGE regions


Location: 4184196..4226949
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G7048_RS19110 (G7048_19105) - 4184196..4184942 (-) 747 WP_166069663.1 hypothetical protein -
  G7048_RS19115 (G7048_19110) - 4184942..4185526 (-) 585 WP_166069664.1 hypothetical protein -
  G7048_RS19120 (G7048_19115) - 4185584..4186033 (-) 450 WP_166069665.1 hypothetical protein -
  G7048_RS19125 (G7048_19120) ssb 4186042..4186539 (-) 498 WP_166069666.1 single-stranded DNA-binding protein Machinery gene
  G7048_RS19130 (G7048_19125) - 4186585..4187250 (-) 666 WP_166069667.1 hypothetical protein -
  G7048_RS19135 (G7048_19130) - 4187243..4188058 (-) 816 WP_166069668.1 hypothetical protein -
  G7048_RS19140 (G7048_19135) - 4188070..4189134 (-) 1065 WP_166069669.1 hypothetical protein -
  G7048_RS19145 (G7048_19140) - 4189131..4189427 (-) 297 WP_166069670.1 hypothetical protein -
  G7048_RS19150 (G7048_19145) - 4189790..4189948 (-) 159 WP_166069671.1 hypothetical protein -
  G7048_RS19155 (G7048_19150) - 4189945..4190196 (-) 252 WP_166069673.1 hypothetical protein -
  G7048_RS19160 (G7048_19155) - 4190206..4190466 (-) 261 WP_166069674.1 hypothetical protein -
  G7048_RS19165 (G7048_19160) - 4190573..4191181 (-) 609 WP_240933037.1 DNA cytosine methyltransferase -
  G7048_RS19170 (G7048_19165) - 4191574..4191720 (-) 147 WP_166069675.1 hypothetical protein -
  G7048_RS19175 (G7048_19170) - 4191772..4191975 (-) 204 WP_166069676.1 hypothetical protein -
  G7048_RS19180 (G7048_19175) - 4192064..4192603 (-) 540 WP_166069677.1 hypothetical protein -
  G7048_RS19185 (G7048_19180) - 4193330..4193557 (-) 228 WP_166069678.1 hypothetical protein -
  G7048_RS19190 (G7048_19185) - 4193696..4194319 (-) 624 WP_166069679.1 NYN domain-containing protein -
  G7048_RS19195 (G7048_19190) - 4194549..4195316 (-) 768 WP_166069680.1 hypothetical protein -
  G7048_RS19200 (G7048_19195) - 4195335..4196012 (-) 678 WP_166069681.1 S24 family peptidase -
  G7048_RS19205 (G7048_19200) - 4196075..4196302 (+) 228 WP_166069682.1 helix-turn-helix transcriptional regulator -
  G7048_RS19210 (G7048_19205) - 4196295..4196681 (+) 387 WP_166069683.1 hypothetical protein -
  G7048_RS19215 (G7048_19210) - 4196870..4197097 (+) 228 WP_166069684.1 hypothetical protein -
  G7048_RS19220 (G7048_19215) - 4197124..4197336 (+) 213 WP_166069685.1 hypothetical protein -
  G7048_RS19225 (G7048_19220) - 4197371..4197553 (+) 183 WP_166069686.1 hypothetical protein -
  G7048_RS19230 (G7048_19225) - 4197753..4198043 (+) 291 WP_166069687.1 hypothetical protein -
  G7048_RS19235 (G7048_19230) - 4198010..4198327 (-) 318 WP_166069688.1 hypothetical protein -
  G7048_RS19240 (G7048_19235) - 4198661..4198981 (+) 321 WP_166069689.1 hypothetical protein -
  G7048_RS19245 (G7048_19240) - 4198978..4200765 (+) 1788 WP_166069690.1 toprim domain-containing protein -
  G7048_RS19250 (G7048_19245) - 4200756..4201292 (-) 537 WP_166069691.1 hypothetical protein -
  G7048_RS19255 (G7048_19250) - 4201470..4201760 (+) 291 WP_166069692.1 hypothetical protein -
  G7048_RS19260 (G7048_19255) - 4201757..4201909 (+) 153 WP_166069693.1 hypothetical protein -
  G7048_RS19265 (G7048_19260) - 4201909..4202439 (+) 531 WP_166069694.1 hypothetical protein -
  G7048_RS19270 (G7048_19265) - 4202701..4203270 (+) 570 WP_166069695.1 recombination protein NinG -
  G7048_RS19275 (G7048_19270) - 4203267..4203734 (+) 468 WP_166069696.1 hypothetical protein -
  G7048_RS19280 (G7048_19275) - 4203745..4204221 (+) 477 WP_166069697.1 hypothetical protein -
  G7048_RS19285 (G7048_19280) - 4204243..4204875 (+) 633 WP_166069698.1 hypothetical protein -
  G7048_RS19300 (G7048_19295) - 4205489..4205755 (-) 267 WP_166069699.1 helix-turn-helix domain-containing protein -
  G7048_RS19305 (G7048_19300) - 4205905..4206105 (+) 201 WP_166071065.1 HNH endonuclease -
  G7048_RS19310 (G7048_19305) - 4206108..4206326 (+) 219 WP_166069700.1 hypothetical protein -
  G7048_RS19315 (G7048_19310) - 4206475..4206789 (+) 315 WP_166069701.1 hypothetical protein -
  G7048_RS19320 (G7048_19315) - 4206801..4208498 (+) 1698 WP_166069702.1 terminase large subunit -
  G7048_RS19325 (G7048_19320) - 4208508..4209746 (+) 1239 WP_166066873.1 phage portal protein -
  G7048_RS19330 (G7048_19325) - 4209724..4210572 (+) 849 WP_166069703.1 head maturation protease, ClpP-related -
  G7048_RS19335 (G7048_19330) - 4210569..4211747 (+) 1179 WP_166066871.1 phage major capsid protein -
  G7048_RS19340 (G7048_19335) - 4211759..4211917 (+) 159 WP_166069704.1 hypothetical protein -
  G7048_RS19345 (G7048_19340) - 4211920..4212261 (+) 342 WP_166066869.1 head-tail connector protein -
  G7048_RS19350 (G7048_19345) - 4212264..4212590 (+) 327 WP_166069705.1 phage head closure protein -
  G7048_RS19355 (G7048_19350) - 4212590..4213021 (+) 432 WP_166069706.1 hypothetical protein -
  G7048_RS19360 (G7048_19355) - 4213018..4213371 (+) 354 WP_166069707.1 DUF3168 domain-containing protein -
  G7048_RS28675 - 4213382..4213504 (-) 123 WP_256376531.1 hypothetical protein -
  G7048_RS19365 (G7048_19360) - 4213503..4214150 (+) 648 WP_166069708.1 phage tail tube protein -
  G7048_RS19370 (G7048_19365) - 4214258..4214650 (+) 393 WP_166069709.1 phage tail assembly chaperone -
  G7048_RS28340 - 4214797..4214967 (+) 171 WP_240933038.1 DUF1799 domain-containing protein -
  G7048_RS19380 (G7048_19375) - 4215035..4215496 (+) 462 WP_166069711.1 hypothetical protein -
  G7048_RS19385 (G7048_19380) - 4215632..4220932 (+) 5301 WP_166069712.1 phage tail length tape measure family protein -
  G7048_RS19390 (G7048_19385) - 4220929..4221846 (+) 918 WP_166066859.1 carbohydrate-binding protein -
  G7048_RS19395 (G7048_19390) - 4221843..4222994 (+) 1152 WP_166069713.1 hypothetical protein -
  G7048_RS19400 (G7048_19395) - 4222994..4223689 (+) 696 WP_166069715.1 hypothetical protein -
  G7048_RS19405 (G7048_19400) - 4223697..4224257 (+) 561 WP_166069716.1 hypothetical protein -
  G7048_RS19410 (G7048_19405) - 4224346..4224573 (+) 228 WP_166069041.1 hypothetical protein -
  G7048_RS19415 (G7048_19410) - 4224557..4225186 (+) 630 WP_166069042.1 lysozyme -
  G7048_RS19420 (G7048_19415) - 4225183..4225506 (+) 324 WP_166069717.1 DUF6527 family protein -
  G7048_RS19425 (G7048_19420) - 4225482..4226000 (+) 519 WP_166069718.1 lysis system i-spanin subunit Rz -
  G7048_RS19430 (G7048_19425) - 4226008..4226949 (-) 942 WP_166069719.1 hypothetical protein -

Sequence


Protein


Download         Length: 165 a.a.        Molecular weight: 18303.15 Da        Isoelectric Point: 6.4875

>NTDB_id=428556 G7048_RS19125 WP_166069666.1 4186042..4186539(-) (ssb) [Diaphorobacter sp. HDW4B]
MASVNKVIIVGNLGRDPEMRTFPSGDQVANVTIATTDRWRDKTTGENKEATEWHRVTFNGRLAEIAGQYLRKGSQVYVEG
SLRTRKWTDPQSGQERYSTEIRADQMQMLGSRQGSGDDSRQHEYDEPAPRPAPAPRAPAQRQAPAPAPRQAGGSGFDDMD
SDIPF

Nucleotide


Download         Length: 498 bp        

>NTDB_id=428556 G7048_RS19125 WP_166069666.1 4186042..4186539(-) (ssb) [Diaphorobacter sp. HDW4B]
ATGGCATCCGTCAACAAAGTCATCATCGTTGGCAATTTGGGCCGCGACCCAGAAATGCGCACCTTTCCCAGCGGCGACCA
AGTGGCGAACGTCACCATTGCCACAACCGACCGCTGGCGCGACAAGACGACTGGCGAAAACAAAGAGGCGACCGAATGGC
ATCGCGTCACGTTCAATGGCCGTCTGGCAGAGATCGCAGGTCAGTACCTGCGCAAGGGCTCGCAAGTCTATGTGGAAGGC
AGCCTGCGCACCCGCAAGTGGACCGACCCACAAAGCGGCCAAGAACGCTACTCAACTGAAATCCGCGCCGATCAAATGCA
GATGCTTGGAAGCCGCCAAGGTAGTGGCGACGATAGCCGACAGCATGAGTATGACGAGCCAGCGCCCCGCCCTGCTCCAG
CGCCACGCGCACCAGCCCAACGGCAGGCCCCAGCGCCTGCGCCGCGTCAGGCGGGCGGTAGCGGCTTCGATGACATGGAC
TCGGACATCCCATTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6G8C0D9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

54.494

100

0.588

  ssb Glaesserella parasuis strain SC1401

49.724

100

0.545

  ssb Neisseria meningitidis MC58

42.077

100

0.467

  ssb Neisseria gonorrhoeae MS11

43.429

100

0.461