Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   C2750_RS06005 Genome accession   NZ_CP049682
Coordinates   1163306..1163740 (+) Length   144 a.a.
NCBI ID   WP_215333750.1    Uniprot ID   -
Organism   Polynucleobacter paneuropaeus strain AP-RePozz9-10-D2     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1125999..1165999 1163306..1163740 within 0


Gene organization within MGE regions


Location: 1125999..1165999
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2750_RS05770 (C2750_05780) - 1125999..1126958 (-) 960 WP_215333661.1 hypothetical protein -
  C2750_RS05775 (C2750_05785) - 1126955..1127398 (-) 444 WP_215333663.1 GNAT family N-acetyltransferase -
  C2750_RS05780 (C2750_05790) - 1127404..1127616 (-) 213 WP_215333665.1 hypothetical protein -
  C2750_RS05785 (C2750_05795) - 1127609..1128112 (-) 504 WP_215333667.1 hypothetical protein -
  C2750_RS05790 (C2750_05800) - 1128112..1128600 (-) 489 WP_215333669.1 lysozyme -
  C2750_RS05795 (C2750_05805) - 1128597..1128800 (-) 204 WP_215333671.1 hypothetical protein -
  C2750_RS05800 (C2750_05810) - 1128800..1129006 (-) 207 WP_215333673.1 hypothetical protein -
  C2750_RS05805 (C2750_05815) - 1129009..1129245 (-) 237 WP_215333675.1 hypothetical protein -
  C2750_RS08900 (C2750_05820) - 1129220..1130590 (-) 1371 WP_342356922.1 reverse transcriptase/maturase family protein -
  C2750_RS05815 (C2750_05825) avd 1130494..1130862 (-) 369 WP_215333677.1 diversity-generating retroelement protein Avd -
  C2750_RS05820 (C2750_05830) - 1130879..1131925 (-) 1047 WP_215333679.1 hypothetical protein -
  C2750_RS05825 (C2750_05835) - 1131938..1132939 (-) 1002 WP_215333680.1 hypothetical protein -
  C2750_RS05830 (C2750_05840) - 1133014..1141458 (-) 8445 WP_215333682.1 hypothetical protein -
  C2750_RS05835 (C2750_05845) - 1141451..1143595 (-) 2145 WP_215333684.1 transglycosylase SLT domain-containing protein -
  C2750_RS05840 (C2750_05850) - 1143667..1144242 (-) 576 WP_215333686.1 hypothetical protein -
  C2750_RS08855 - 1144301..1146607 (-) 2307 WP_244973648.1 hypothetical protein -
  C2750_RS05850 (C2750_05860) - 1146607..1147275 (-) 669 WP_215333688.1 hypothetical protein -
  C2750_RS05855 (C2750_05865) - 1147342..1147530 (-) 189 WP_215333690.1 hypothetical protein -
  C2750_RS05860 (C2750_05870) - 1147544..1148008 (-) 465 WP_215333692.1 Bbp16 family capsid cement protein -
  C2750_RS05865 (C2750_05875) - 1148077..1149081 (-) 1005 WP_215333694.1 major capsid protein -
  C2750_RS05870 (C2750_05880) - 1149104..1149796 (-) 693 WP_215333696.1 protease -
  C2750_RS05875 (C2750_05885) - 1149756..1150097 (-) 342 WP_215333698.1 endopeptidase -
  C2750_RS05880 (C2750_05890) gp10 1150136..1150450 (-) 315 WP_215333700.1 capsid staple protein -
  C2750_RS05885 (C2750_05895) - 1150460..1150729 (-) 270 WP_215333702.1 hypothetical protein -
  C2750_RS05890 (C2750_05900) - 1150742..1152451 (-) 1710 WP_215333704.1 portal protein -
  C2750_RS05895 (C2750_05905) - 1152456..1153049 (-) 594 WP_215333706.1 hypothetical protein -
  C2750_RS05900 (C2750_05910) - 1153046..1153411 (-) 366 WP_215333708.1 hypothetical protein -
  C2750_RS05905 (C2750_05915) - 1153412..1153744 (-) 333 WP_215333710.1 hypothetical protein -
  C2750_RS05910 (C2750_05920) - 1153741..1154259 (-) 519 WP_215333712.1 hypothetical protein -
  C2750_RS05915 (C2750_05925) - 1154321..1154494 (-) 174 WP_215333714.1 hypothetical protein -
  C2750_RS05920 (C2750_05930) - 1154491..1155813 (-) 1323 WP_215333716.1 terminase family protein -
  C2750_RS05925 (C2750_05935) - 1155806..1156069 (-) 264 WP_215333718.1 hypothetical protein -
  C2750_RS05930 (C2750_05940) - 1156077..1156346 (-) 270 WP_215333720.1 hypothetical protein -
  C2750_RS05935 (C2750_05945) - 1156336..1156887 (-) 552 WP_215333722.1 recombination protein NinG -
  C2750_RS05940 (C2750_05950) - 1156884..1157312 (-) 429 WP_215333724.1 recombination protein NinB -
  C2750_RS05945 - 1157526..1158362 (-) 837 WP_215333726.1 YdaU family protein -
  C2750_RS05950 (C2750_05960) - 1158359..1158655 (-) 297 WP_215333728.1 hypothetical protein -
  C2750_RS05955 (C2750_05965) - 1158652..1158963 (-) 312 WP_215333730.1 CII family transcriptional regulator -
  C2750_RS05960 (C2750_05970) - 1158956..1159192 (-) 237 WP_215333732.1 YdaS family helix-turn-helix protein -
  C2750_RS05965 (C2750_05975) - 1159267..1159893 (+) 627 WP_215333734.1 S24 family peptidase -
  C2750_RS05970 (C2750_05980) - 1159893..1160126 (+) 234 WP_215333736.1 hypothetical protein -
  C2750_RS05975 (C2750_05985) - 1160503..1160655 (+) 153 WP_215333738.1 hypothetical protein -
  C2750_RS05980 (C2750_05990) bet 1160679..1161422 (+) 744 WP_215333740.1 phage recombination protein Bet -
  C2750_RS05985 (C2750_05995) - 1161422..1162057 (+) 636 WP_215333742.1 lambda exonuclease family protein -
  C2750_RS05990 (C2750_06000) - 1162078..1162407 (+) 330 WP_215333744.1 hypothetical protein -
  C2750_RS05995 (C2750_06005) - 1162413..1162634 (+) 222 WP_215333746.1 hypothetical protein -
  C2750_RS06000 (C2750_06010) - 1162631..1163062 (+) 432 WP_215333748.1 dATP/dGTP diphosphohydrolase domain-containing protein -
  C2750_RS06005 (C2750_06015) ssb 1163306..1163740 (+) 435 WP_215333750.1 single-stranded DNA-binding protein Machinery gene
  C2750_RS06010 (C2750_06020) - 1163903..1164238 (+) 336 WP_215333752.1 hypothetical protein -
  C2750_RS06015 (C2750_06025) - 1164238..1164780 (+) 543 WP_215333754.1 hypothetical protein -
  C2750_RS06020 (C2750_06030) - 1164780..1164980 (+) 201 WP_215333756.1 DUF4224 domain-containing protein -
  C2750_RS06025 (C2750_06035) - 1164980..1165999 (+) 1020 WP_244973649.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 144 a.a.        Molecular weight: 15605.55 Da        Isoelectric Point: 5.2880

>NTDB_id=426529 C2750_RS06005 WP_215333750.1 1163306..1163740(+) (ssb) [Polynucleobacter paneuropaeus strain AP-RePozz9-10-D2]
MASVNKVIVVGNLGKDPETRYMPSGDAVCNFSVATTDKWKDKQSGETKEATEWHRISAFGKLAEICGQYLKKGSQGYFEG
KLQTRKFTDAAGIEKYSTEIRLETMQMLGGKPSGGAEVPEGYSKTQQSPAPEGGLGAMDDDIPF

Nucleotide


Download         Length: 435 bp        

>NTDB_id=426529 C2750_RS06005 WP_215333750.1 1163306..1163740(+) (ssb) [Polynucleobacter paneuropaeus strain AP-RePozz9-10-D2]
ATGGCATCAGTTAATAAAGTAATCGTAGTAGGTAATTTGGGCAAAGATCCAGAAACGCGTTATATGCCATCTGGCGACGC
GGTATGTAATTTCAGCGTAGCGACTACCGACAAATGGAAAGACAAACAATCAGGCGAAACCAAAGAGGCTACTGAATGGC
ATCGTATTTCTGCCTTTGGAAAATTGGCTGAGATCTGCGGTCAATACCTAAAAAAAGGTAGCCAAGGTTACTTTGAAGGA
AAACTACAAACTAGAAAGTTTACGGACGCTGCTGGTATTGAAAAGTATTCCACAGAGATTAGATTAGAAACAATGCAAAT
GCTTGGCGGTAAACCATCTGGCGGAGCTGAAGTACCAGAGGGCTATAGCAAGACTCAGCAATCCCCAGCACCAGAAGGCG
GCCTTGGCGCAATGGATGATGACATTCCTTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

48.588

100

0.597

  ssb Neisseria gonorrhoeae MS11

44.828

100

0.542

  ssb Neisseria meningitidis MC58

53.906

88.889

0.479

  ssb Glaesserella parasuis strain SC1401

58.261

79.861

0.465