Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   G5S32_RS05140 Genome accession   NZ_CP049331
Coordinates   1144758..1145279 (-) Length   173 a.a.
NCBI ID   WP_165310998.1    Uniprot ID   A0A6G7CHA3
Organism   Vibrio ziniensis strain ZWAL4003     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1143183..1191156 1144758..1145279 within 0


Gene organization within MGE regions


Location: 1143183..1191156
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G5S32_RS05130 (G5S32_05130) - 1143183..1144430 (-) 1248 WP_165310994.1 site-specific integrase -
  G5S32_RS05135 (G5S32_05135) xisR 1144442..1144681 (-) 240 WP_165310996.1 excisionase family protein -
  G5S32_RS05140 (G5S32_05140) ssb 1144758..1145279 (-) 522 WP_165310998.1 single-stranded DNA-binding protein Machinery gene
  G5S32_RS05145 (G5S32_05145) - 1145279..1145542 (-) 264 WP_165311000.1 hypothetical protein -
  G5S32_RS05150 (G5S32_05150) - 1145621..1146211 (-) 591 WP_165311002.1 3'-5' exoribonuclease -
  G5S32_RS05155 (G5S32_05155) - 1146261..1147079 (-) 819 WP_165311004.1 DUF2303 family protein -
  G5S32_RS05160 (G5S32_05160) - 1147120..1147518 (-) 399 WP_165311006.1 hypothetical protein -
  G5S32_RS05165 (G5S32_05165) - 1147670..1148296 (-) 627 WP_165311008.1 hypothetical protein -
  G5S32_RS05170 (G5S32_05170) - 1148331..1148654 (-) 324 WP_165311010.1 hypothetical protein -
  G5S32_RS05175 (G5S32_05175) - 1148673..1149455 (-) 783 WP_165311012.1 S24 family peptidase -
  G5S32_RS05180 (G5S32_05180) - 1149492..1149695 (+) 204 WP_165311014.1 helix-turn-helix domain-containing protein -
  G5S32_RS05185 (G5S32_05185) - 1149751..1150224 (+) 474 WP_165311016.1 YmfL family putative regulatory protein -
  G5S32_RS05190 (G5S32_05190) - 1150221..1150478 (+) 258 WP_165311018.1 hypothetical protein -
  G5S32_RS05195 (G5S32_05195) - 1150478..1150639 (+) 162 WP_165311020.1 hypothetical protein -
  G5S32_RS05200 (G5S32_05200) - 1150632..1151168 (+) 537 WP_165311022.1 DNA methyltransferase -
  G5S32_RS05205 (G5S32_05205) - 1151153..1152118 (+) 966 WP_165311024.1 helix-turn-helix domain-containing protein -
  G5S32_RS05210 (G5S32_05210) - 1152108..1152311 (+) 204 WP_165311026.1 hypothetical protein -
  G5S32_RS05215 (G5S32_05215) - 1152314..1153012 (+) 699 WP_165311027.1 phage regulatory protein/antirepressor Ant -
  G5S32_RS05220 (G5S32_05220) - 1152958..1154007 (+) 1050 WP_246201038.1 DUF968 domain-containing protein -
  G5S32_RS21665 - 1154599..1155003 (+) 405 Protein_1000 SIR2 family protein -
  G5S32_RS05230 (G5S32_05230) - 1155752..1155895 (+) 144 Protein_1001 DUF3265 domain-containing protein -
  G5S32_RS05235 (G5S32_05235) - 1155904..1156554 (+) 651 WP_165311028.1 zinc ribbon domain-containing protein -
  G5S32_RS05240 (G5S32_05240) - 1156876..1157943 (-) 1068 WP_165311029.1 Abi family protein -
  G5S32_RS05245 (G5S32_05245) - 1158826..1160058 (+) 1233 WP_165311030.1 DUF6161 domain-containing protein -
  G5S32_RS05250 (G5S32_05250) - 1160101..1160442 (+) 342 WP_165311031.1 hypothetical protein -
  G5S32_RS05255 (G5S32_05255) - 1160598..1161431 (+) 834 WP_165311032.1 GIY-YIG nuclease family protein -
  G5S32_RS05260 (G5S32_05260) - 1161564..1162031 (+) 468 WP_165311033.1 Sbal_3080 family lipoprotein -
  G5S32_RS05265 (G5S32_05265) - 1162206..1162655 (+) 450 WP_165311034.1 hypothetical protein -
  G5S32_RS05270 (G5S32_05270) - 1162721..1163110 (-) 390 WP_165311035.1 hypothetical protein -
  G5S32_RS05275 (G5S32_05275) - 1163184..1163849 (+) 666 WP_165311036.1 hypothetical protein -
  G5S32_RS05280 (G5S32_05280) - 1164005..1164211 (+) 207 WP_246201040.1 phage holin family protein -
  G5S32_RS05285 (G5S32_05285) - 1164198..1164686 (+) 489 WP_165311038.1 lysozyme -
  G5S32_RS05290 (G5S32_05290) - 1164659..1165147 (+) 489 WP_165311039.1 lysis protein -
  G5S32_RS05295 (G5S32_05295) - 1165237..1165821 (+) 585 WP_165311040.1 hypothetical protein -
  G5S32_RS05300 (G5S32_05300) - 1165730..1167688 (+) 1959 WP_165311041.1 terminase gpA endonuclease subunit -
  G5S32_RS05305 (G5S32_05305) gpW 1167688..1167897 (+) 210 WP_207621600.1 gpW family head-tail joining protein -
  G5S32_RS05310 (G5S32_05310) - 1167897..1169456 (+) 1560 WP_165311043.1 phage portal protein -
  G5S32_RS05315 (G5S32_05315) - 1169449..1170792 (+) 1344 WP_165311044.1 S49 family peptidase -
  G5S32_RS05320 (G5S32_05320) - 1170803..1171141 (+) 339 WP_165311045.1 head decoration protein -
  G5S32_RS05325 (G5S32_05325) - 1171180..1172220 (+) 1041 WP_165311046.1 major capsid protein -
  G5S32_RS05330 (G5S32_05330) - 1172287..1172802 (+) 516 WP_165311047.1 hypothetical protein -
  G5S32_RS05335 (G5S32_05335) - 1172835..1173098 (+) 264 WP_246201041.1 head-tail joining protein -
  G5S32_RS05340 (G5S32_05340) - 1173095..1173724 (+) 630 WP_165311049.1 phage tail protein -
  G5S32_RS05345 (G5S32_05345) gpU 1173714..1174163 (+) 450 WP_165311050.1 phage tail terminator protein -
  G5S32_RS05350 (G5S32_05350) - 1174166..1174678 (+) 513 WP_165311051.1 phage tail tube protein -
  G5S32_RS05355 (G5S32_05355) - 1174681..1175124 (+) 444 WP_165311052.1 phage minor tail protein G -
  G5S32_RS05360 (G5S32_05360) - 1175193..1175471 (+) 279 WP_246201043.1 phage tail assembly protein T -
  G5S32_RS05365 (G5S32_05365) - 1175452..1177635 (+) 2184 WP_165311053.1 hypothetical protein -
  G5S32_RS05370 (G5S32_05370) - 1177637..1178230 (+) 594 WP_165311054.1 hypothetical protein -
  G5S32_RS05375 (G5S32_05375) - 1178227..1178781 (+) 555 WP_165311055.1 DUF2163 domain-containing protein -
  G5S32_RS21465 - 1178785..1183716 (+) 4932 WP_207621601.1 hypothetical protein -
  G5S32_RS05385 (G5S32_05385) - 1183762..1186950 (+) 3189 WP_165311056.1 hypothetical protein -
  G5S32_RS05390 (G5S32_05390) tnpA 1187129..1187590 (+) 462 WP_165311057.1 IS200/IS605 family transposase -
  G5S32_RS05395 (G5S32_05395) - 1187711..1188463 (+) 753 WP_165311058.1 DUF4376 domain-containing protein -
  G5S32_RS05400 (G5S32_05400) - 1188773..1190392 (+) 1620 WP_165311059.1 trypsin-like serine protease -
  G5S32_RS05405 (G5S32_05405) - 1190560..1191156 (-) 597 WP_165311060.1 Fic family protein -

Sequence


Protein


Download         Length: 173 a.a.        Molecular weight: 19258.60 Da        Isoelectric Point: 7.4195

>NTDB_id=426157 G5S32_RS05140 WP_165310998.1 1144758..1145279(-) (ssb) [Vibrio ziniensis strain ZWAL4003]
MASRGVNKVILVGNLGSDPEVRYMPSGGAVANITIATSETWRDKSSGQQREKTEWHRVTLYGKLAEVAGEHLRKGSQVYI
EGQLQTRKWQDQSGQDRFSTEVVVQGYNGVMQMLGSKRDQGWGQSQQPISSLGNQSPHHAPPPPQYNEPPMDFDDDIPLV
PMFKPHRSLSLCV

Nucleotide


Download         Length: 522 bp        

>NTDB_id=426157 G5S32_RS05140 WP_165310998.1 1144758..1145279(-) (ssb) [Vibrio ziniensis strain ZWAL4003]
ATGGCTAGCCGTGGAGTAAACAAAGTCATCCTAGTAGGAAACTTAGGCAGTGATCCAGAGGTGCGTTATATGCCTTCTGG
TGGAGCTGTTGCCAACATCACTATAGCCACCAGCGAAACGTGGCGAGATAAATCGTCAGGTCAGCAACGCGAAAAAACAG
AGTGGCACCGAGTAACCCTGTACGGAAAGCTTGCTGAAGTCGCTGGTGAACACTTAAGAAAAGGTTCGCAAGTCTACATC
GAAGGTCAGCTACAAACTCGTAAATGGCAGGACCAATCAGGACAAGATCGATTTTCAACAGAGGTTGTAGTTCAGGGATA
CAACGGAGTGATGCAAATGCTAGGTAGTAAACGCGACCAAGGATGGGGGCAATCTCAACAACCAATTAGTAGTCTGGGAA
ATCAATCGCCACACCATGCACCACCGCCGCCTCAATATAATGAACCACCTATGGATTTCGATGATGATATCCCTCTGGTT
CCAATGTTTAAACCGCATCGCTCACTTAGTCTGTGCGTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6G7CHA3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

74.011

100

0.757

  ssb Glaesserella parasuis strain SC1401

50

100

0.526

  ssb Neisseria gonorrhoeae MS11

44.633

100

0.457

  ssb Neisseria meningitidis MC58

44.068

100

0.451