Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   IE382_RS15490 Genome accession   NZ_CP061870
Coordinates   2850767..2851150 (-) Length   127 a.a.
NCBI ID   WP_041334965.1    Uniprot ID   -
Organism   Bacillus subtilis strain FX-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2845767..2856150
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IE382_RS15450 (IE382_15385) sinI 2846707..2846880 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  IE382_RS15455 (IE382_15390) sinR 2846914..2847249 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  IE382_RS15460 (IE382_15395) tasA 2847342..2848127 (-) 786 WP_017696201.1 biofilm matrix protein TasA -
  IE382_RS15465 (IE382_15400) sipW 2848192..2848764 (-) 573 WP_072557060.1 signal peptidase I -
  IE382_RS15470 (IE382_15405) tapA 2848748..2849503 (-) 756 WP_017696199.1 amyloid fiber anchoring/assembly protein TapA -
  IE382_RS15475 (IE382_15410) yqzG 2849774..2850100 (+) 327 WP_026113671.1 YqzG/YhdC family protein -
  IE382_RS15480 (IE382_15415) spoIIT 2850142..2850321 (-) 180 WP_014480252.1 YqzE family protein -
  IE382_RS15485 (IE382_15420) comGG 2850392..2850766 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  IE382_RS15490 (IE382_15425) comGF 2850767..2851150 (-) 384 WP_041334965.1 ComG operon protein ComGF Machinery gene
  IE382_RS15495 (IE382_15430) comGE 2851176..2851523 (-) 348 WP_041334967.1 ComG operon protein 5 Machinery gene
  IE382_RS15500 (IE382_15435) comGD 2851507..2851938 (-) 432 WP_041334970.1 comG operon protein ComGD Machinery gene
  IE382_RS15505 (IE382_15440) comGC 2851928..2852224 (-) 297 WP_041334973.1 comG operon protein ComGC Machinery gene
  IE382_RS15510 (IE382_15445) comGB 2852238..2853275 (-) 1038 WP_041334977.1 comG operon protein ComGB Machinery gene
  IE382_RS15515 (IE382_15450) comGA 2853262..2854332 (-) 1071 WP_017696192.1 competence protein ComGA Machinery gene
  IE382_RS15520 (IE382_15460) corA 2854742..2855695 (-) 954 WP_017696189.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14319.42 Da        Isoelectric Point: 6.2112

>NTDB_id=423519 IE382_RS15490 WP_041334965.1 2850767..2851150(-) (comGF) [Bacillus subtilis strain FX-1]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADFVNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=423519 IE382_RS15490 WP_041334965.1 2850767..2851150(-) (comGF) [Bacillus subtilis strain FX-1]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCAATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGTAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976