Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   G3T51_RS11050 Genome accession   NZ_CP048732
Coordinates   2237342..2237833 (-) Length   163 a.a.
NCBI ID   WP_185160466.1    Uniprot ID   A0AAW5LF21
Organism   Mammaliicoccus sciuri strain NWAF26     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2205874..2243947 2237342..2237833 within 0


Gene organization within MGE regions


Location: 2205874..2243947
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G3T51_RS10825 - 2205874..2206071 (-) 198 WP_185160445.1 hypothetical protein -
  G3T51_RS10830 - 2206545..2207399 (-) 855 WP_185160446.1 N-acetylmuramoyl-L-alanine amidase -
  G3T51_RS10835 - 2207484..2207936 (-) 453 WP_058591511.1 holin family protein -
  G3T51_RS14830 - 2208006..2208503 (-) 498 WP_231493076.1 XkdX family protein -
  G3T51_RS10845 - 2208506..2210161 (-) 1656 WP_185160447.1 BppU family phage baseplate upper protein -
  G3T51_RS10850 - 2210176..2211882 (-) 1707 WP_185160448.1 phosphodiester glycosidase family protein -
  G3T51_RS10855 - 2211895..2212413 (-) 519 WP_185160449.1 hypothetical protein -
  G3T51_RS10860 - 2212406..2213959 (-) 1554 WP_185160450.1 prophage endopeptidase tail family protein -
  G3T51_RS10865 - 2213970..2214803 (-) 834 WP_185160451.1 phage tail family protein -
  G3T51_RS10870 - 2214800..2219572 (-) 4773 WP_185160452.1 tape measure protein -
  G3T51_RS10875 gpGT 2219605..2220114 (-) 510 WP_185160550.1 phage tail assembly chaperone GT -
  G3T51_RS10880 gpG 2220130..2220489 (-) 360 WP_152291802.1 phage tail assembly chaperone G -
  G3T51_RS10885 - 2220566..2221051 (-) 486 WP_185160453.1 Ig-like domain-containing protein -
  G3T51_RS10890 - 2221146..2221742 (-) 597 WP_058591522.1 major tail protein -
  G3T51_RS10895 - 2221764..2222159 (-) 396 WP_231493075.1 hypothetical protein -
  G3T51_RS10900 - 2222156..2222548 (-) 393 WP_185160454.1 hypothetical protein -
  G3T51_RS10905 - 2222539..2222871 (-) 333 WP_185160455.1 hypothetical protein -
  G3T51_RS10910 - 2222855..2223154 (-) 300 WP_185160456.1 head-tail connector protein -
  G3T51_RS10915 - 2223228..2224397 (-) 1170 Protein_2112 phage major capsid protein -
  G3T51_RS10920 - 2224563..2225150 (-) 588 WP_096791164.1 HK97 family phage prohead protease -
  G3T51_RS10925 - 2225143..2226396 (-) 1254 WP_152291807.1 phage portal protein -
  G3T51_RS10930 - 2226419..2226625 (-) 207 WP_096791162.1 hypothetical protein -
  G3T51_RS10935 - 2226636..2228336 (-) 1701 WP_152291808.1 terminase large subunit -
  G3T51_RS10940 - 2228333..2228788 (-) 456 WP_058591531.1 phage terminase small subunit P27 family -
  G3T51_RS10945 - 2229028..2229462 (-) 435 WP_152291810.1 HNH endonuclease -
  G3T51_RS10950 - 2229473..2229634 (-) 162 WP_172965076.1 hypothetical protein -
  G3T51_RS10955 - 2229837..2230295 (-) 459 WP_152291811.1 hypothetical protein -
  G3T51_RS10960 - 2230262..2230429 (-) 168 WP_172965077.1 hypothetical protein -
  G3T51_RS10965 - 2230434..2230667 (-) 234 WP_172965078.1 hypothetical protein -
  G3T51_RS10970 - 2230767..2230964 (-) 198 WP_152291813.1 hypothetical protein -
  G3T51_RS10975 - 2230966..2231133 (-) 168 WP_172965079.1 hypothetical protein -
  G3T51_RS10980 - 2231227..2231475 (-) 249 WP_152291814.1 hypothetical protein -
  G3T51_RS10985 - 2231479..2231682 (-) 204 WP_152291815.1 Lar family restriction alleviation protein -
  G3T51_RS10990 - 2231686..2232036 (-) 351 WP_152291816.1 hypothetical protein -
  G3T51_RS10995 - 2232040..2232414 (-) 375 WP_185160458.1 YopX family protein -
  G3T51_RS11000 - 2232956..2233258 (-) 303 WP_135016157.1 MazG-like family protein -
  G3T51_RS11005 - 2233260..2233490 (-) 231 WP_185160459.1 hypothetical protein -
  G3T51_RS11010 - 2233493..2233693 (-) 201 WP_185160460.1 hypothetical protein -
  G3T51_RS11015 - 2233695..2234048 (-) 354 WP_185160461.1 hypothetical protein -
  G3T51_RS11020 - 2234157..2234861 (+) 705 WP_185160462.1 CPBP family intramembrane glutamic endopeptidase -
  G3T51_RS11025 - 2234886..2235110 (-) 225 WP_058591540.1 hypothetical protein -
  G3T51_RS11030 - 2235113..2235439 (-) 327 WP_185160463.1 SA1788 family PVL leukocidin-associated protein -
  G3T51_RS11035 - 2235436..2235624 (-) 189 WP_058591542.1 hypothetical protein -
  G3T51_RS11040 - 2235636..2236658 (-) 1023 WP_185160464.1 phage replisome organizer N-terminal domain-containing protein -
  G3T51_RS11045 - 2236651..2237322 (-) 672 WP_185160465.1 putative HNHc nuclease -
  G3T51_RS11050 ssbA 2237342..2237833 (-) 492 WP_185160466.1 single-stranded DNA-binding protein Machinery gene
  G3T51_RS11055 - 2237830..2238489 (-) 660 WP_185160467.1 ERF family protein -
  G3T51_RS11060 - 2238490..2238975 (-) 486 WP_185160468.1 siphovirus Gp157 family protein -
  G3T51_RS11065 - 2238968..2239237 (-) 270 WP_185160469.1 hypothetical protein -
  G3T51_RS11070 - 2239240..2239500 (-) 261 WP_058591548.1 hypothetical protein -
  G3T51_RS11075 - 2239670..2240521 (+) 852 WP_185160470.1 DUF4393 domain-containing protein -
  G3T51_RS11080 - 2240614..2240778 (-) 165 WP_185160471.1 hypothetical protein -
  G3T51_RS11085 - 2240775..2241086 (-) 312 WP_185160472.1 DUF771 domain-containing protein -
  G3T51_RS11090 - 2241150..2241404 (-) 255 WP_185160473.1 BetR domain protein -
  G3T51_RS11095 - 2241578..2241886 (+) 309 WP_185160474.1 helix-turn-helix domain-containing protein -
  G3T51_RS11100 - 2241891..2242349 (+) 459 WP_185160475.1 ImmA/IrrE family metallo-endopeptidase -
  G3T51_RS11105 - 2242364..2242840 (+) 477 WP_185160476.1 hypothetical protein -
  G3T51_RS11110 - 2242889..2243947 (+) 1059 WP_185160477.1 site-specific integrase -

Sequence

Protein


Download         Length: 163 a.a.        Molecular weight: 18764.62 Da        Isoelectric Point: 6.9484

>NTDB_id=422582 G3T51_RS11050 WP_185160466.1 2237342..2237833(-) (ssbA) [Mammaliicoccus sciuri strain NWAF26]
MINRVVLVGRLTKEPEYRVTPSGVQVATFTLAINRTFTNQNGERQADFINCVVFRTPAENVNKYLNKGNLAGIEGRLQSR
SYENNEGKRVYVTEVVCDSVQFLEPKSNNQQQSNYQPPQYNQQQGYQQQNYQQSNNYQQPQQQHNPFTNANGPIDIKDDD
LPF

Nucleotide


Download         Length: 492 bp        

>NTDB_id=422582 G3T51_RS11050 WP_185160466.1 2237342..2237833(-) (ssbA) [Mammaliicoccus sciuri strain NWAF26]
ATGATCAATCGAGTTGTACTAGTCGGAAGATTAACAAAAGAACCTGAATATAGAGTGACTCCATCTGGTGTACAAGTTGC
GACATTCACATTAGCAATCAATAGAACATTTACTAATCAAAATGGAGAAAGACAAGCAGATTTTATTAATTGTGTTGTAT
TTAGAACACCCGCAGAAAATGTTAATAAGTATTTAAATAAAGGTAATTTAGCAGGCATTGAAGGCAGACTTCAGTCAAGA
AGTTATGAAAACAATGAAGGTAAACGTGTTTATGTCACAGAAGTTGTATGTGACAGTGTGCAATTCCTAGAACCGAAAAG
TAATAACCAACAGCAGAGTAACTATCAACCACCTCAATATAATCAACAACAAGGTTACCAACAACAGAATTATCAACAAT
CAAACAATTACCAGCAACCACAACAACAGCATAATCCATTTACCAATGCGAATGGACCAATCGATATAAAGGATGATGAT
TTACCTTTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.747

100

0.595
  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.528
  ssb Glaesserella parasuis strain SC1401

33.898

100

0.368
  ssbB Bacillus subtilis subsp. subtilis str. 168

55.66

65.031

0.362

Multiple sequence alignment