Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   G3M69_RS00435 Genome accession   NZ_CP048599
Coordinates   94883..94996 (-) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   A0A1A9H2U2
Organism   Helicobacter pylori strain GCT 97     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 89883..99996
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G3M69_RS00415 (G3M69_00415) - 90548..91960 (-) 1413 WP_163562708.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  G3M69_RS00420 (G3M69_00420) comB10 92031..93161 (-) 1131 WP_163562709.1 DNA type IV secretion system protein ComB10 Machinery gene
  G3M69_RS00425 (G3M69_00425) comB9 93154..94143 (-) 990 WP_163562710.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  G3M69_RS00430 (G3M69_00430) comB8 94143..94886 (-) 744 WP_121066139.1 virB8 family protein Machinery gene
  G3M69_RS00435 (G3M69_00435) comB7 94883..94996 (-) 114 WP_001217877.1 hypothetical protein Machinery gene
  G3M69_RS00440 (G3M69_00440) comB6 95012..96067 (-) 1056 WP_163498375.1 P-type conjugative transfer protein TrbL Machinery gene
  G3M69_RS00445 (G3M69_00445) - 96075..97079 (-) 1005 WP_163563472.1 PDZ domain-containing protein -
  G3M69_RS00450 (G3M69_00450) - 97079..97381 (-) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  G3M69_RS00455 (G3M69_00455) panD 97384..97737 (-) 354 WP_000142241.1 aspartate 1-decarboxylase -
  G3M69_RS00460 (G3M69_00460) - 97727..99955 (-) 2229 WP_163562711.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=421658 G3M69_RS00435 WP_001217877.1 94883..94996(-) (comB7) [Helicobacter pylori strain GCT 97]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=421658 G3M69_RS00435 WP_001217877.1 94883..94996(-) (comB7) [Helicobacter pylori strain GCT 97]
ATGAGGATTTTTTTTGTTATTATGGGACTTGTGCTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAGAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1A9H2U2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973

Multiple sequence alignment