Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | GWQ43_RS05610 | Genome accession | NZ_CP048039 |
| Coordinates | 1239594..1240049 (+) | Length | 151 a.a. |
| NCBI ID | WP_162089927.1 | Uniprot ID | - |
| Organism | Alcaligenes faecalis strain MUB14 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1218883..1268360 | 1239594..1240049 | within | 0 |
Gene organization within MGE regions
Location: 1218883..1268360
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GWQ43_RS05535 (GWQ43_05530) | - | 1219048..1219260 (-) | 213 | WP_162089914.1 | DNA-binding protein | - |
| GWQ43_RS05540 (GWQ43_05535) | - | 1219396..1219647 (-) | 252 | WP_238399703.1 | helix-turn-helix transcriptional regulator | - |
| GWQ43_RS05545 (GWQ43_05540) | - | 1220316..1220690 (-) | 375 | WP_162089915.1 | helix-turn-helix domain-containing protein | - |
| GWQ43_RS05550 (GWQ43_05545) | - | 1221163..1222284 (-) | 1122 | WP_162089916.1 | Fic family protein | - |
| GWQ43_RS05555 (GWQ43_05550) | - | 1222330..1222830 (-) | 501 | WP_162089917.1 | VUT family protein | - |
| GWQ43_RS05560 (GWQ43_05555) | - | 1223132..1224004 (+) | 873 | WP_162089918.1 | hypothetical protein | - |
| GWQ43_RS05565 (GWQ43_05560) | dbpB | 1224001..1224960 (+) | 960 | WP_162089919.1 | DGQHR domain-containing protein DpdB | - |
| GWQ43_RS05575 (GWQ43_05570) | dpdH | 1226126..1229170 (+) | 3045 | WP_274381319.1 | protein DpdH | - |
| GWQ43_RS05580 (GWQ43_05575) | dpdI | 1229167..1229883 (+) | 717 | WP_162089922.1 | protein DpdI | - |
| GWQ43_RS05585 (GWQ43_05580) | dpdJ | 1229896..1234458 (+) | 4563 | WP_238399704.1 | protein DpdJ | - |
| GWQ43_RS05590 (GWQ43_05585) | dpdK | 1234455..1234988 (+) | 534 | WP_162089923.1 | phospholipase D-like domain-containing protein DpdK | - |
| GWQ43_RS05595 (GWQ43_05590) | dpdD | 1234985..1237249 (+) | 2265 | WP_162089924.1 | protein DpdD | - |
| GWQ43_RS05600 (GWQ43_05595) | - | 1237594..1238127 (+) | 534 | WP_162089925.1 | JAB domain-containing protein | - |
| GWQ43_RS05605 (GWQ43_05600) | - | 1238721..1239530 (+) | 810 | WP_162089926.1 | DUF3560 domain-containing protein | - |
| GWQ43_RS05610 (GWQ43_05605) | ssb | 1239594..1240049 (+) | 456 | WP_162089927.1 | single-stranded DNA-binding protein | Machinery gene |
| GWQ43_RS05615 (GWQ43_05610) | - | 1240898..1242721 (-) | 1824 | WP_162089928.1 | hypothetical protein | - |
| GWQ43_RS05620 (GWQ43_05615) | mobF | 1243243..1246143 (-) | 2901 | WP_162089929.1 | MobF family relaxase | - |
| GWQ43_RS05625 (GWQ43_05620) | - | 1246366..1246662 (+) | 297 | WP_162089930.1 | hypothetical protein | - |
| GWQ43_RS05630 (GWQ43_05625) | - | 1246792..1248606 (+) | 1815 | WP_162089931.1 | hypothetical protein | - |
| GWQ43_RS05635 (GWQ43_05630) | - | 1248957..1249568 (-) | 612 | WP_162089932.1 | hypothetical protein | - |
| GWQ43_RS05640 (GWQ43_05635) | - | 1249844..1251499 (-) | 1656 | WP_162089933.1 | type IV secretion system DNA-binding domain-containing protein | - |
| GWQ43_RS05645 (GWQ43_05640) | - | 1251512..1251946 (-) | 435 | WP_162089934.1 | hypothetical protein | - |
| GWQ43_RS05650 (GWQ43_05645) | stbB | 1251955..1252662 (-) | 708 | WP_162089935.1 | StbB family protein | - |
| GWQ43_RS05655 (GWQ43_05650) | - | 1252659..1253096 (-) | 438 | WP_162089936.1 | hypothetical protein | - |
| GWQ43_RS05660 (GWQ43_05655) | - | 1253442..1254359 (-) | 918 | WP_162089937.1 | TrfA | - |
| GWQ43_RS05665 (GWQ43_05660) | virB11 | 1254508..1255515 (-) | 1008 | WP_162089938.1 | P-type DNA transfer ATPase VirB11 | - |
| GWQ43_RS05670 (GWQ43_05665) | virB10 | 1255493..1256626 (-) | 1134 | WP_162089939.1 | type IV secretion system protein VirB10 | - |
| GWQ43_RS05675 (GWQ43_05670) | - | 1256623..1257510 (-) | 888 | WP_162089940.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| GWQ43_RS05680 (GWQ43_05675) | - | 1257538..1258224 (-) | 687 | WP_162089941.1 | virB8 family protein | - |
| GWQ43_RS05685 (GWQ43_05680) | - | 1258228..1258365 (-) | 138 | WP_162089942.1 | conjugal transfer protein | - |
| GWQ43_RS05690 (GWQ43_05685) | - | 1258434..1259321 (-) | 888 | WP_238399707.1 | type IV secretion system protein | - |
| GWQ43_RS05695 (GWQ43_05690) | - | 1259394..1260098 (-) | 705 | WP_162089944.1 | type IV secretion system protein | - |
| GWQ43_RS05700 (GWQ43_05695) | - | 1260136..1260519 (-) | 384 | WP_162089945.1 | hypothetical protein | - |
| GWQ43_RS05705 (GWQ43_05700) | - | 1260708..1261454 (-) | 747 | WP_162089946.1 | hypothetical protein | - |
| GWQ43_RS05710 (GWQ43_05705) | - | 1261473..1263899 (-) | 2427 | WP_162089947.1 | VirB4 family type IV secretion/conjugal transfer ATPase | - |
| GWQ43_RS05715 (GWQ43_05710) | - | 1263911..1264231 (-) | 321 | WP_162089948.1 | type IV secretion system protein VirB3 | - |
| GWQ43_RS05720 (GWQ43_05715) | - | 1264235..1264555 (-) | 321 | WP_162089949.1 | TrbC/VirB2 family protein | - |
| GWQ43_RS05725 (GWQ43_05720) | - | 1264648..1265301 (-) | 654 | WP_162089950.1 | lytic transglycosylase domain-containing protein | - |
| GWQ43_RS05730 (GWQ43_05725) | - | 1265317..1265976 (-) | 660 | WP_162089951.1 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| GWQ43_RS05735 (GWQ43_05730) | - | 1266032..1266325 (-) | 294 | WP_162089952.1 | plasmid mobilization protein | - |
| GWQ43_RS05740 (GWQ43_05735) | - | 1266431..1266766 (-) | 336 | WP_162089953.1 | helix-turn-helix domain-containing protein | - |
| GWQ43_RS05745 (GWQ43_05740) | - | 1266759..1267127 (-) | 369 | WP_162089954.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| GWQ43_RS05750 (GWQ43_05745) | - | 1267236..1268303 (-) | 1068 | WP_162089955.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 151 a.a. Molecular weight: 16774.65 Da Isoelectric Point: 6.4887
>NTDB_id=419639 GWQ43_RS05610 WP_162089927.1 1239594..1240049(+) (ssb) [Alcaligenes faecalis strain MUB14]
MASLNRVTLIGNLGKDPELRYTAEGAAVCSVSIATSSHWKDKASGERREETEWHRVVFYGRLAEVAGEYLRKGRTVFVEG
RLQTRKWQDADNGIDRYSTEIIAEQMQMLGGRPDGQVEESRAESATRSKSRGGKGKQTAAPVEDEPSDIPF
MASLNRVTLIGNLGKDPELRYTAEGAAVCSVSIATSSHWKDKASGERREETEWHRVVFYGRLAEVAGEYLRKGRTVFVEG
RLQTRKWQDADNGIDRYSTEIIAEQMQMLGGRPDGQVEESRAESATRSKSRGGKGKQTAAPVEDEPSDIPF
Nucleotide
Download Length: 456 bp
>NTDB_id=419639 GWQ43_RS05610 WP_162089927.1 1239594..1240049(+) (ssb) [Alcaligenes faecalis strain MUB14]
ATGGCTTCATTGAATCGTGTCACCCTGATCGGCAACCTGGGCAAGGATCCCGAACTGCGCTATACCGCAGAGGGAGCCGC
CGTATGCTCGGTATCCATCGCTACAAGCAGCCATTGGAAGGATAAGGCCAGCGGCGAGCGCCGCGAAGAAACCGAATGGC
ATCGCGTGGTGTTTTATGGCCGACTGGCCGAAGTGGCCGGGGAGTATCTGCGCAAGGGCCGCACGGTCTTTGTGGAGGGG
CGGCTCCAAACTCGCAAATGGCAGGATGCAGACAACGGCATCGACCGTTACAGCACCGAGATCATCGCCGAGCAAATGCA
GATGTTGGGCGGTCGCCCTGATGGACAGGTAGAGGAGTCCAGGGCAGAGTCTGCTACCCGCTCCAAGAGTCGAGGCGGTA
AGGGGAAGCAGACTGCAGCCCCTGTAGAGGATGAGCCGTCAGATATTCCATTCTGA
ATGGCTTCATTGAATCGTGTCACCCTGATCGGCAACCTGGGCAAGGATCCCGAACTGCGCTATACCGCAGAGGGAGCCGC
CGTATGCTCGGTATCCATCGCTACAAGCAGCCATTGGAAGGATAAGGCCAGCGGCGAGCGCCGCGAAGAAACCGAATGGC
ATCGCGTGGTGTTTTATGGCCGACTGGCCGAAGTGGCCGGGGAGTATCTGCGCAAGGGCCGCACGGTCTTTGTGGAGGGG
CGGCTCCAAACTCGCAAATGGCAGGATGCAGACAACGGCATCGACCGTTACAGCACCGAGATCATCGCCGAGCAAATGCA
GATGTTGGGCGGTCGCCCTGATGGACAGGTAGAGGAGTCCAGGGCAGAGTCTGCTACCCGCTCCAAGAGTCGAGGCGGTA
AGGGGAAGCAGACTGCAGCCCCTGTAGAGGATGAGCCGTCAGATATTCCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Neisseria meningitidis MC58 |
43.429 |
100 |
0.503 |
| ssb | Neisseria gonorrhoeae MS11 |
43.429 |
100 |
0.503 |
| ssb | Vibrio cholerae strain A1552 |
63.559 |
78.146 |
0.497 |
| ssb | Glaesserella parasuis strain SC1401 |
59.13 |
76.159 |
0.45 |