Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   GWQ43_RS05610 Genome accession   NZ_CP048039
Coordinates   1239594..1240049 (+) Length   151 a.a.
NCBI ID   WP_162089927.1    Uniprot ID   -
Organism   Alcaligenes faecalis strain MUB14     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1218883..1268360 1239594..1240049 within 0


Gene organization within MGE regions


Location: 1218883..1268360
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GWQ43_RS05535 (GWQ43_05530) - 1219048..1219260 (-) 213 WP_162089914.1 DNA-binding protein -
  GWQ43_RS05540 (GWQ43_05535) - 1219396..1219647 (-) 252 WP_238399703.1 helix-turn-helix transcriptional regulator -
  GWQ43_RS05545 (GWQ43_05540) - 1220316..1220690 (-) 375 WP_162089915.1 helix-turn-helix domain-containing protein -
  GWQ43_RS05550 (GWQ43_05545) - 1221163..1222284 (-) 1122 WP_162089916.1 Fic family protein -
  GWQ43_RS05555 (GWQ43_05550) - 1222330..1222830 (-) 501 WP_162089917.1 VUT family protein -
  GWQ43_RS05560 (GWQ43_05555) - 1223132..1224004 (+) 873 WP_162089918.1 hypothetical protein -
  GWQ43_RS05565 (GWQ43_05560) dbpB 1224001..1224960 (+) 960 WP_162089919.1 DGQHR domain-containing protein DpdB -
  GWQ43_RS05575 (GWQ43_05570) dpdH 1226126..1229170 (+) 3045 WP_274381319.1 protein DpdH -
  GWQ43_RS05580 (GWQ43_05575) dpdI 1229167..1229883 (+) 717 WP_162089922.1 protein DpdI -
  GWQ43_RS05585 (GWQ43_05580) dpdJ 1229896..1234458 (+) 4563 WP_238399704.1 protein DpdJ -
  GWQ43_RS05590 (GWQ43_05585) dpdK 1234455..1234988 (+) 534 WP_162089923.1 phospholipase D-like domain-containing protein DpdK -
  GWQ43_RS05595 (GWQ43_05590) dpdD 1234985..1237249 (+) 2265 WP_162089924.1 protein DpdD -
  GWQ43_RS05600 (GWQ43_05595) - 1237594..1238127 (+) 534 WP_162089925.1 JAB domain-containing protein -
  GWQ43_RS05605 (GWQ43_05600) - 1238721..1239530 (+) 810 WP_162089926.1 DUF3560 domain-containing protein -
  GWQ43_RS05610 (GWQ43_05605) ssb 1239594..1240049 (+) 456 WP_162089927.1 single-stranded DNA-binding protein Machinery gene
  GWQ43_RS05615 (GWQ43_05610) - 1240898..1242721 (-) 1824 WP_162089928.1 hypothetical protein -
  GWQ43_RS05620 (GWQ43_05615) mobF 1243243..1246143 (-) 2901 WP_162089929.1 MobF family relaxase -
  GWQ43_RS05625 (GWQ43_05620) - 1246366..1246662 (+) 297 WP_162089930.1 hypothetical protein -
  GWQ43_RS05630 (GWQ43_05625) - 1246792..1248606 (+) 1815 WP_162089931.1 hypothetical protein -
  GWQ43_RS05635 (GWQ43_05630) - 1248957..1249568 (-) 612 WP_162089932.1 hypothetical protein -
  GWQ43_RS05640 (GWQ43_05635) - 1249844..1251499 (-) 1656 WP_162089933.1 type IV secretion system DNA-binding domain-containing protein -
  GWQ43_RS05645 (GWQ43_05640) - 1251512..1251946 (-) 435 WP_162089934.1 hypothetical protein -
  GWQ43_RS05650 (GWQ43_05645) stbB 1251955..1252662 (-) 708 WP_162089935.1 StbB family protein -
  GWQ43_RS05655 (GWQ43_05650) - 1252659..1253096 (-) 438 WP_162089936.1 hypothetical protein -
  GWQ43_RS05660 (GWQ43_05655) - 1253442..1254359 (-) 918 WP_162089937.1 TrfA -
  GWQ43_RS05665 (GWQ43_05660) virB11 1254508..1255515 (-) 1008 WP_162089938.1 P-type DNA transfer ATPase VirB11 -
  GWQ43_RS05670 (GWQ43_05665) virB10 1255493..1256626 (-) 1134 WP_162089939.1 type IV secretion system protein VirB10 -
  GWQ43_RS05675 (GWQ43_05670) - 1256623..1257510 (-) 888 WP_162089940.1 TrbG/VirB9 family P-type conjugative transfer protein -
  GWQ43_RS05680 (GWQ43_05675) - 1257538..1258224 (-) 687 WP_162089941.1 virB8 family protein -
  GWQ43_RS05685 (GWQ43_05680) - 1258228..1258365 (-) 138 WP_162089942.1 conjugal transfer protein -
  GWQ43_RS05690 (GWQ43_05685) - 1258434..1259321 (-) 888 WP_238399707.1 type IV secretion system protein -
  GWQ43_RS05695 (GWQ43_05690) - 1259394..1260098 (-) 705 WP_162089944.1 type IV secretion system protein -
  GWQ43_RS05700 (GWQ43_05695) - 1260136..1260519 (-) 384 WP_162089945.1 hypothetical protein -
  GWQ43_RS05705 (GWQ43_05700) - 1260708..1261454 (-) 747 WP_162089946.1 hypothetical protein -
  GWQ43_RS05710 (GWQ43_05705) - 1261473..1263899 (-) 2427 WP_162089947.1 VirB4 family type IV secretion/conjugal transfer ATPase -
  GWQ43_RS05715 (GWQ43_05710) - 1263911..1264231 (-) 321 WP_162089948.1 type IV secretion system protein VirB3 -
  GWQ43_RS05720 (GWQ43_05715) - 1264235..1264555 (-) 321 WP_162089949.1 TrbC/VirB2 family protein -
  GWQ43_RS05725 (GWQ43_05720) - 1264648..1265301 (-) 654 WP_162089950.1 lytic transglycosylase domain-containing protein -
  GWQ43_RS05730 (GWQ43_05725) - 1265317..1265976 (-) 660 WP_162089951.1 TrbM/KikA/MpfK family conjugal transfer protein -
  GWQ43_RS05735 (GWQ43_05730) - 1266032..1266325 (-) 294 WP_162089952.1 plasmid mobilization protein -
  GWQ43_RS05740 (GWQ43_05735) - 1266431..1266766 (-) 336 WP_162089953.1 helix-turn-helix domain-containing protein -
  GWQ43_RS05745 (GWQ43_05740) - 1266759..1267127 (-) 369 WP_162089954.1 type II toxin-antitoxin system RelE/ParE family toxin -
  GWQ43_RS05750 (GWQ43_05745) - 1267236..1268303 (-) 1068 WP_162089955.1 site-specific integrase -

Sequence


Protein


Download         Length: 151 a.a.        Molecular weight: 16774.65 Da        Isoelectric Point: 6.4887

>NTDB_id=419639 GWQ43_RS05610 WP_162089927.1 1239594..1240049(+) (ssb) [Alcaligenes faecalis strain MUB14]
MASLNRVTLIGNLGKDPELRYTAEGAAVCSVSIATSSHWKDKASGERREETEWHRVVFYGRLAEVAGEYLRKGRTVFVEG
RLQTRKWQDADNGIDRYSTEIIAEQMQMLGGRPDGQVEESRAESATRSKSRGGKGKQTAAPVEDEPSDIPF

Nucleotide


Download         Length: 456 bp        

>NTDB_id=419639 GWQ43_RS05610 WP_162089927.1 1239594..1240049(+) (ssb) [Alcaligenes faecalis strain MUB14]
ATGGCTTCATTGAATCGTGTCACCCTGATCGGCAACCTGGGCAAGGATCCCGAACTGCGCTATACCGCAGAGGGAGCCGC
CGTATGCTCGGTATCCATCGCTACAAGCAGCCATTGGAAGGATAAGGCCAGCGGCGAGCGCCGCGAAGAAACCGAATGGC
ATCGCGTGGTGTTTTATGGCCGACTGGCCGAAGTGGCCGGGGAGTATCTGCGCAAGGGCCGCACGGTCTTTGTGGAGGGG
CGGCTCCAAACTCGCAAATGGCAGGATGCAGACAACGGCATCGACCGTTACAGCACCGAGATCATCGCCGAGCAAATGCA
GATGTTGGGCGGTCGCCCTGATGGACAGGTAGAGGAGTCCAGGGCAGAGTCTGCTACCCGCTCCAAGAGTCGAGGCGGTA
AGGGGAAGCAGACTGCAGCCCCTGTAGAGGATGAGCCGTCAGATATTCCATTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Neisseria meningitidis MC58

43.429

100

0.503

  ssb Neisseria gonorrhoeae MS11

43.429

100

0.503

  ssb Vibrio cholerae strain A1552

63.559

78.146

0.497

  ssb Glaesserella parasuis strain SC1401

59.13

76.159

0.45


Multiple sequence alignment