Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   FX986_RS03675 Genome accession   NZ_CP047970
Coordinates   899013..899558 (+) Length   181 a.a.
NCBI ID   WP_191237463.1    Uniprot ID   -
Organism   Cobetia marina strain GPM2     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 874860..940781 899013..899558 within 0


Gene organization within MGE regions


Location: 874860..940781
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FX986_RS03495 - 874860..878663 (-) 3804 WP_191237435.1 hypothetical protein -
  FX986_RS03500 - 878735..878926 (-) 192 WP_054557059.1 hypothetical protein -
  FX986_RS03505 - 878939..879685 (-) 747 WP_191237436.1 hypothetical protein -
  FX986_RS03510 - 879689..880129 (-) 441 WP_054557057.1 hypothetical protein -
  FX986_RS03515 - 880126..880704 (-) 579 WP_191237437.1 hypothetical protein -
  FX986_RS03520 - 880716..881261 (-) 546 WP_191237438.1 head-tail adaptor protein -
  FX986_RS03525 - 881269..881598 (-) 330 WP_054557054.1 head-tail connector protein -
  FX986_RS03530 - 881676..882911 (-) 1236 WP_191237439.1 phage major capsid protein -
  FX986_RS03535 - 882927..883529 (-) 603 WP_191237440.1 HK97 family phage prohead protease -
  FX986_RS03540 - 883526..884746 (-) 1221 WP_191237441.1 phage portal protein -
  FX986_RS03545 - 884743..884907 (-) 165 WP_191237442.1 hypothetical protein -
  FX986_RS03550 - 884909..886618 (-) 1710 WP_191237443.1 terminase large subunit -
  FX986_RS03555 - 886625..887104 (-) 480 WP_191237444.1 phage terminase small subunit P27 family -
  FX986_RS17885 - 887237..887593 (-) 357 WP_191237445.1 HNH endonuclease -
  FX986_RS17890 - 887699..887908 (+) 210 WP_191237446.1 DUF2188 domain-containing protein -
  FX986_RS03570 - 887955..888146 (+) 192 WP_166019411.1 DUF2188 domain-containing protein -
  FX986_RS03575 - 888152..888370 (-) 219 WP_191237447.1 hypothetical protein -
  FX986_RS03580 - 888354..888779 (-) 426 WP_191237448.1 hypothetical protein -
  FX986_RS03585 - 888767..889120 (-) 354 WP_131431534.1 phage holin, lambda family -
  FX986_RS03590 - 889165..889695 (-) 531 WP_191237449.1 glycoside hydrolase family 104 protein -
  FX986_RS03595 - 890204..890596 (-) 393 WP_191237450.1 hypothetical protein -
  FX986_RS03600 - 890654..891211 (-) 558 WP_191237451.1 hypothetical protein -
  FX986_RS03605 - 891247..891783 (-) 537 WP_191237452.1 VRR-NUC domain-containing protein -
  FX986_RS03610 - 891780..892064 (-) 285 WP_191237453.1 hypothetical protein -
  FX986_RS03615 - 892246..892602 (-) 357 WP_191237454.1 hypothetical protein -
  FX986_RS03620 - 892595..893338 (-) 744 WP_191237455.1 replication protein P -
  FX986_RS03625 - 893280..894179 (-) 900 WP_191237456.1 DnaT-like ssDNA-binding domain-containing protein -
  FX986_RS03630 - 894176..894436 (-) 261 WP_152965445.1 hypothetical protein -
  FX986_RS03635 - 894433..894753 (-) 321 WP_054557037.1 hypothetical protein -
  FX986_RS03640 - 894835..895299 (-) 465 WP_191237457.1 phage regulatory CII family protein -
  FX986_RS03645 - 895392..895580 (-) 189 WP_191237458.1 Cro/CI family transcriptional regulator -
  FX986_RS03650 - 895696..896388 (+) 693 WP_191237459.1 XRE family transcriptional regulator -
  FX986_RS03655 - 896669..897352 (+) 684 WP_191237460.1 MerR family transcriptional regulator -
  FX986_RS03660 - 897336..897755 (+) 420 WP_191237461.1 hypothetical protein -
  FX986_RS03665 - 897798..898010 (+) 213 WP_191237462.1 hypothetical protein -
  FX986_RS03670 - 898171..898446 (+) 276 WP_084208163.1 hypothetical protein -
  FX986_RS03675 ssb 899013..899558 (+) 546 WP_191237463.1 single-stranded DNA-binding protein Machinery gene
  FX986_RS03680 - 899668..900330 (+) 663 WP_191237464.1 hypothetical protein -
  FX986_RS03685 - 900327..901241 (+) 915 WP_191237465.1 DNA cytosine methyltransferase -
  FX986_RS03690 - 901426..901575 (+) 150 WP_160317839.1 hypothetical protein -
  FX986_RS03695 - 901589..901822 (+) 234 WP_166019389.1 helix-turn-helix transcriptional regulator -
  FX986_RS03700 - 901791..903035 (-) 1245 WP_191237466.1 tyrosine-type recombinase/integrase -
  FX986_RS03710 - 903370..905745 (-) 2376 WP_191237467.1 EAL domain-containing protein -
  FX986_RS03715 trpA 906216..907055 (-) 840 WP_084208158.1 tryptophan synthase subunit alpha -
  FX986_RS03720 trpB 907181..908416 (-) 1236 WP_191237468.1 tryptophan synthase subunit beta -
  FX986_RS03725 - 908598..909566 (+) 969 WP_191237469.1 LysR family transcriptional regulator -
  FX986_RS03730 purU 909684..910538 (-) 855 WP_077374535.1 formyltetrahydrofolate deformylase -
  FX986_RS03735 - 910902..912482 (+) 1581 WP_084209644.1 ribonuclease J -
  FX986_RS03740 - 912697..912984 (-) 288 WP_077374537.1 hypothetical protein -
  FX986_RS03745 moaA 913223..914209 (-) 987 WP_169477207.1 GTP 3',8-cyclase MoaA -
  FX986_RS03750 - 914209..914772 (-) 564 WP_077374541.1 molybdenum cofactor biosynthesis protein MoaE -
  FX986_RS03755 moaC 914774..915589 (-) 816 WP_191237470.1 cyclic pyranopterin monophosphate synthase MoaC -
  FX986_RS03760 glp 915757..917127 (-) 1371 WP_254696538.1 gephyrin-like molybdotransferase Glp -
  FX986_RS03765 mobB 917163..917786 (-) 624 WP_191237472.1 molybdopterin-guanine dinucleotide biosynthesis protein B -
  FX986_RS03770 mobA 918257..919006 (-) 750 WP_191237473.1 molybdenum cofactor guanylyltransferase MobA -
  FX986_RS03775 - 919102..919794 (-) 693 WP_191237474.1 ATP-binding cassette domain-containing protein -
  FX986_RS03780 - 919983..920657 (-) 675 WP_205632739.1 ABC transporter permease -
  FX986_RS03785 - 920684..921613 (-) 930 WP_084208151.1 substrate-binding domain-containing protein -
  FX986_RS03790 - 922171..923703 (+) 1533 WP_191237475.1 sigma-54-dependent transcriptional regulator -
  FX986_RS03795 - 923700..925961 (+) 2262 WP_191237476.1 cache domain-containing protein -
  FX986_RS03800 - 926002..926688 (+) 687 WP_191237477.1 helix-turn-helix domain-containing protein -
  FX986_RS03805 - 926834..928006 (-) 1173 WP_240704262.1 uracil-xanthine permease family protein -
  FX986_RS03810 upp 928237..928866 (-) 630 WP_077374565.1 uracil phosphoribosyltransferase -
  FX986_RS03815 - 928991..930199 (-) 1209 WP_191237478.1 glycosyltransferase -
  FX986_RS03820 - 930348..930968 (-) 621 WP_167592976.1 sulfotransferase family 2 domain-containing protein -
  FX986_RS03825 - 931194..932069 (+) 876 WP_254696539.1 glycosyltransferase family 8 protein -
  FX986_RS03830 - 932133..933323 (-) 1191 WP_191237479.1 glycosyltransferase family 4 protein -
  FX986_RS03835 ung 933360..934073 (-) 714 WP_141392391.1 uracil-DNA glycosylase -
  FX986_RS03840 gpt 934075..934572 (-) 498 WP_077374580.1 xanthine phosphoribosyltransferase -
  FX986_RS03845 - 934744..935289 (-) 546 WP_077374582.1 adenine phosphoribosyltransferase -
  FX986_RS03850 - 935289..936590 (-) 1302 WP_084208142.1 NCS2 family permease -
  FX986_RS03855 - 936891..937502 (-) 612 WP_136938677.1 riboflavin synthase subunit alpha -
  FX986_RS03860 - 938125..939168 (+) 1044 WP_077374589.1 methionine ABC transporter ATP-binding protein -
  FX986_RS03865 - 939149..939802 (+) 654 WP_077374591.1 methionine ABC transporter permease -
  FX986_RS03870 - 939963..940781 (+) 819 WP_077375588.1 MetQ/NlpA family ABC transporter substrate-binding protein -

Sequence

Protein


Download         Length: 181 a.a.        Molecular weight: 19962.01 Da        Isoelectric Point: 7.4651

>NTDB_id=418832 FX986_RS03675 WP_191237463.1 899013..899558(+) (ssb) [Cobetia marina strain GPM2]
MARGINKAILIGHLGQDPEVRFTPSGSAVANLSIATTDKWRDRQTGNVQERTEWHRVVMFNKTAEIAQQYLKKGAQVYIE
GRLQTRKWKDQQGIERYSTEIVANDMQMLGGSGGGQPSQTQRPPAQQGYQQPPQQQGGYQHPAPASTHHGVGQPSTSQQQ
TNSFGAPPAGSFDDFDDEIPF

Nucleotide


Download         Length: 546 bp        

>NTDB_id=418832 FX986_RS03675 WP_191237463.1 899013..899558(+) (ssb) [Cobetia marina strain GPM2]
ATGGCCCGCGGCATCAACAAGGCGATCCTGATCGGCCATCTCGGCCAAGACCCAGAGGTGCGCTTCACCCCCAGCGGCTC
AGCCGTGGCCAACCTCAGTATCGCCACCACTGACAAGTGGCGAGACAGGCAGACCGGCAACGTCCAGGAACGCACCGAAT
GGCATCGGGTGGTGATGTTCAACAAGACCGCCGAGATTGCTCAGCAGTACCTCAAGAAAGGCGCTCAGGTGTACATCGAA
GGACGCTTGCAGACTCGCAAGTGGAAGGACCAGCAAGGCATCGAACGCTACAGCACCGAGATCGTCGCCAATGACATGCA
GATGCTCGGCGGTTCCGGTGGCGGCCAGCCCTCCCAGACACAGCGTCCGCCAGCTCAGCAGGGCTATCAGCAGCCACCCC
AGCAGCAAGGCGGCTACCAGCACCCGGCGCCCGCCAGCACGCATCACGGTGTAGGTCAGCCATCTACAAGCCAACAACAG
ACAAACAGCTTCGGGGCTCCGCCAGCCGGCAGCTTCGATGACTTTGATGACGAGATCCCGTTCTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(5-109)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

52.941

100

0.547
  ssb Neisseria gonorrhoeae MS11

48.333

99.448

0.481
  ssb Neisseria meningitidis MC58

47.778

99.448

0.475
  ssb Glaesserella parasuis strain SC1401

45.161

100

0.464

Multiple sequence alignment