Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   GWG04_RS07540 Genome accession   NZ_CP047922
Coordinates   1478226..1478696 (-) Length   156 a.a.
NCBI ID   WP_029549393.1    Uniprot ID   -
Organism   Staphylococcus aureus strain SR231     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1446011..1488251 1478226..1478696 within 0


Gene organization within MGE regions


Location: 1446011..1488251
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GWG04_RS07315 (GWG04_07320) - 1446011..1446211 (-) 201 WP_000498229.1 hypothetical protein -
  GWG04_RS07320 (GWG04_07325) - 1446225..1446431 (-) 207 WP_000125170.1 hypothetical protein -
  GWG04_RS07325 (GWG04_07330) - 1446914..1447168 (-) 255 WP_031807127.1 hypothetical protein -
  GWG04_RS07330 (GWG04_07335) - 1447223..1448668 (-) 1446 WP_031807126.1 SH3 domain-containing protein -
  GWG04_RS07335 (GWG04_07340) - 1448649..1449086 (-) 438 WP_001556691.1 phage holin -
  GWG04_RS07340 (GWG04_07345) - 1449142..1449537 (-) 396 WP_000398878.1 hypothetical protein -
  GWG04_RS07345 (GWG04_07350) - 1449542..1450780 (-) 1239 WP_064282041.1 BppU family phage baseplate upper protein -
  GWG04_RS07350 (GWG04_07355) - 1450793..1452667 (-) 1875 WP_029265300.1 glucosaminidase domain-containing protein -
  GWG04_RS07355 (GWG04_07360) - 1452804..1453103 (-) 300 WP_000466769.1 DUF2951 domain-containing protein -
  GWG04_RS07360 (GWG04_07365) - 1453144..1453317 (-) 174 WP_001790193.1 XkdX family protein -
  GWG04_RS07365 (GWG04_07370) - 1453321..1453698 (-) 378 WP_000705907.1 DUF2977 domain-containing protein -
  GWG04_RS07370 (GWG04_07375) - 1453698..1455521 (-) 1824 WP_048657605.1 phage baseplate upper protein -
  GWG04_RS07375 (GWG04_07380) - 1455521..1457419 (-) 1899 WP_017431804.1 hypothetical protein -
  GWG04_RS07380 (GWG04_07385) - 1457432..1459318 (-) 1887 WP_001122001.1 SGNH/GDSL hydrolase family protein -
  GWG04_RS07385 (GWG04_07390) - 1459329..1460270 (-) 942 WP_000560181.1 phage tail domain-containing protein -
  GWG04_RS07390 (GWG04_07395) - 1460285..1463428 (-) 3144 WP_000379454.1 hypothetical protein -
  GWG04_RS07395 (GWG04_07400) - 1463432..1463716 (-) 285 WP_000880587.1 hypothetical protein -
  GWG04_RS07400 (GWG04_07405) - 1463761..1464267 (-) 507 WP_031833107.1 tail assembly chaperone -
  GWG04_RS07405 (GWG04_07410) - 1464334..1464891 (-) 558 WP_000057582.1 tail protein -
  GWG04_RS07410 (GWG04_07415) - 1464892..1465317 (-) 426 WP_000270192.1 DUF3168 domain-containing protein -
  GWG04_RS07415 (GWG04_07420) - 1465330..1465743 (-) 414 WP_001151330.1 HK97-gp10 family putative phage morphogenesis protein -
  GWG04_RS07420 (GWG04_07425) - 1465730..1466065 (-) 336 WP_000483041.1 phage head closure protein -
  GWG04_RS07425 (GWG04_07430) - 1466077..1466427 (-) 351 WP_000177351.1 phage head-tail adapter protein -
  GWG04_RS07430 - 1466433..1466576 (-) 144 WP_000002931.1 hypothetical protein -
  GWG04_RS07435 (GWG04_07435) - 1466588..1467502 (-) 915 WP_000235168.1 phage major capsid protein -
  GWG04_RS07440 (GWG04_07440) - 1467519..1468103 (-) 585 WP_001019219.1 DUF4355 domain-containing protein -
  GWG04_RS07445 (GWG04_07445) - 1468206..1468412 (-) 207 WP_000346033.1 hypothetical protein -
  GWG04_RS07450 (GWG04_07450) - 1468414..1469367 (-) 954 WP_000184133.1 phage head morphogenesis protein -
  GWG04_RS07455 (GWG04_07455) - 1469336..1470760 (-) 1425 WP_000177422.1 phage portal protein -
  GWG04_RS07460 (GWG04_07460) - 1470757..1471980 (-) 1224 WP_001037578.1 PBSX family phage terminase large subunit -
  GWG04_RS07465 (GWG04_07465) - 1471973..1472467 (-) 495 WP_000594088.1 terminase small subunit -
  GWG04_RS07470 (GWG04_07470) - 1472820..1473221 (-) 402 WP_000286968.1 hypothetical protein -
  GWG04_RS07475 (GWG04_07475) - 1473222..1473395 (-) 174 WP_000595257.1 transcriptional activator RinB -
  GWG04_RS07480 (GWG04_07480) - 1473392..1473778 (-) 387 WP_000592207.1 hypothetical protein -
  GWG04_RS07485 (GWG04_07485) - 1473775..1473981 (-) 207 WP_000195803.1 DUF1381 domain-containing protein -
  GWG04_RS07490 (GWG04_07490) - 1473978..1474223 (-) 246 WP_057485222.1 hypothetical protein -
  GWG04_RS07495 (GWG04_07495) - 1474260..1474769 (-) 510 WP_031911468.1 dUTP pyrophosphatase -
  GWG04_RS07500 (GWG04_07500) - 1474762..1475004 (-) 243 WP_117220641.1 hypothetical protein -
  GWG04_RS07505 (GWG04_07505) - 1474994..1475230 (-) 237 WP_001065101.1 DUF1024 family protein -
  GWG04_RS07510 (GWG04_07510) - 1475223..1475579 (-) 357 WP_117220642.1 acetyltransferase -
  GWG04_RS14715 - 1475579..1475982 (-) 404 Protein_1464 hypothetical protein -
  GWG04_RS07515 (GWG04_07515) - 1475996..1476238 (-) 243 WP_117220643.1 SAV1978 family virulence-associated passenger protein -
  GWG04_RS07520 (GWG04_07520) - 1476242..1476610 (-) 369 WP_000101273.1 SA1788 family PVL leukocidin-associated protein -
  GWG04_RS07525 (GWG04_07525) - 1476623..1477078 (-) 456 WP_000401965.1 RusA family crossover junction endodeoxyribonuclease -
  GWG04_RS07530 (GWG04_07530) - 1477087..1477305 (-) 219 WP_000338528.1 hypothetical protein -
  GWG04_RS07535 (GWG04_07535) - 1477312..1478196 (-) 885 WP_117220644.1 DnaD domain protein -
  GWG04_RS07540 (GWG04_07540) ssbA 1478226..1478696 (-) 471 WP_029549393.1 single-stranded DNA-binding protein Machinery gene
  GWG04_RS07545 (GWG04_07545) - 1478697..1479314 (-) 618 WP_072528355.1 MBL fold metallo-hydrolase -
  GWG04_RS07550 (GWG04_07550) - 1479395..1480315 (-) 921 WP_000138475.1 recombinase RecT -
  GWG04_RS07555 (GWG04_07555) - 1480317..1482260 (-) 1944 WP_072532628.1 AAA family ATPase -
  GWG04_RS07560 (GWG04_07560) - 1482269..1482532 (-) 264 WP_001205732.1 hypothetical protein -
  GWG04_RS07565 (GWG04_07565) - 1482541..1482801 (-) 261 WP_117220666.1 DUF1108 family protein -
  GWG04_RS07570 (GWG04_07570) - 1482806..1483108 (-) 303 WP_000165363.1 DUF2482 family protein -
  GWG04_RS07575 (GWG04_07575) - 1483201..1483362 (-) 162 WP_000066025.1 DUF1270 domain-containing protein -
  GWG04_RS07580 (GWG04_07580) - 1483516..1483761 (+) 246 WP_000122246.1 hypothetical protein -
  GWG04_RS07585 (GWG04_07585) - 1483729..1483932 (-) 204 Protein_1479 hypothetical protein -
  GWG04_RS07590 (GWG04_07590) - 1483948..1484700 (-) 753 WP_061735430.1 phage antirepressor KilAC domain-containing protein -
  GWG04_RS07595 (GWG04_07595) - 1484857..1485165 (-) 309 WP_001153965.1 hypothetical protein -
  GWG04_RS07600 (GWG04_07600) - 1485180..1485434 (-) 255 WP_001106626.1 helix-turn-helix transcriptional regulator -
  GWG04_RS07605 (GWG04_07605) - 1485624..1486262 (+) 639 WP_077156086.1 XRE family transcriptional regulator -
  GWG04_RS07610 (GWG04_07610) - 1486314..1486814 (+) 501 WP_212563489.1 hypothetical protein -
  GWG04_RS07615 (GWG04_07615) - 1486875..1488251 (+) 1377 WP_046594661.1 recombinase family protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17654.38 Da        Isoelectric Point: 4.6228

>NTDB_id=418422 GWG04_RS07540 WP_029549393.1 1478226..1478696(-) (ssbA) [Staphylococcus aureus strain SR231]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFVNCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNTNDSQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANDPIEIDDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=418422 GWG04_RS07540 WP_029549393.1 1478226..1478696(-) (ssbA) [Staphylococcus aureus strain SR231]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCTTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTGTTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTTTTAGAACCAAAGAA
CACAAATGACTCTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

61.017

100

0.692

  ssb Latilactobacillus sakei subsp. sakei 23K

52.353

100

0.571

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.768

100

0.372


Multiple sequence alignment