Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   E3S64_RS04765 Genome accession   NZ_CP047861
Coordinates   950921..951391 (-) Length   156 a.a.
NCBI ID   WP_000934770.1    Uniprot ID   -
Organism   Staphylococcus aureus strain UP_1322     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 918505..961080 950921..951391 within 0


Gene organization within MGE regions


Location: 918505..961080
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  E3S64_RS04540 (E3S64_04540) - 918505..918960 (-) 456 WP_000971220.1 hypothetical protein -
  E3S64_RS04545 (E3S64_04545) - 918957..919544 (-) 588 WP_000448197.1 hypothetical protein -
  E3S64_RS04550 (E3S64_04550) sak 920080..920571 (-) 492 WP_000920042.1 staphylokinase -
  E3S64_RS04555 (E3S64_04555) - 920762..921517 (-) 756 WP_002955266.1 CHAP domain-containing protein -
  E3S64_RS04560 (E3S64_04560) - 921529..921783 (-) 255 WP_000611512.1 phage holin -
  E3S64_RS04565 (E3S64_04565) - 921841..922236 (-) 396 WP_000398891.1 hypothetical protein -
  E3S64_RS04570 (E3S64_04570) - 922242..923480 (-) 1239 WP_160199659.1 BppU family phage baseplate upper protein -
  E3S64_RS04575 (E3S64_04575) - 923493..925391 (-) 1899 WP_000524015.1 glucosaminidase domain-containing protein -
  E3S64_RS04580 (E3S64_04580) - 925528..925827 (-) 300 WP_000466778.1 DUF2951 domain-containing protein -
  E3S64_RS04585 (E3S64_04585) - 925867..926040 (-) 174 WP_000782200.1 XkdX family protein -
  E3S64_RS04590 (E3S64_04590) - 926044..926421 (-) 378 WP_000705896.1 DUF2977 domain-containing protein -
  E3S64_RS04595 (E3S64_04595) - 926421..928244 (-) 1824 WP_000634521.1 phage baseplate upper protein -
  E3S64_RS04600 (E3S64_04600) - 928244..930154 (-) 1911 WP_042856098.1 hypothetical protein -
  E3S64_RS04605 (E3S64_04605) - 930169..932070 (-) 1902 WP_160199660.1 SGNH/GDSL hydrolase family protein -
  E3S64_RS04610 (E3S64_04610) - 932079..933026 (-) 948 WP_160199661.1 phage tail family protein -
  E3S64_RS04615 (E3S64_04615) - 933039..936503 (-) 3465 WP_103146790.1 hypothetical protein -
  E3S64_RS04620 (E3S64_04620) - 936520..936864 (-) 345 WP_000105584.1 hypothetical protein -
  E3S64_RS04625 (E3S64_04625) - 936894..937259 (-) 366 WP_001100163.1 tail assembly chaperone -
  E3S64_RS04630 (E3S64_04630) - 937322..937903 (-) 582 WP_000002578.1 phage major tail protein, TP901-1 family -
  E3S64_RS04635 (E3S64_04635) - 937922..938305 (-) 384 WP_000188643.1 hypothetical protein -
  E3S64_RS04640 (E3S64_04640) - 938317..938664 (-) 348 WP_001017815.1 HK97-gp10 family putative phage morphogenesis protein -
  E3S64_RS04645 (E3S64_04645) - 938664..938966 (-) 303 WP_001268314.1 hypothetical protein -
  E3S64_RS04650 (E3S64_04650) - 938963..939295 (-) 333 WP_000209972.1 phage head-tail connector protein -
  E3S64_RS04655 (E3S64_04655) - 939304..939591 (-) 288 WP_001114086.1 hypothetical protein -
  E3S64_RS04660 (E3S64_04660) - 939613..940587 (-) 975 WP_000438511.1 phage major capsid protein -
  E3S64_RS04665 (E3S64_04665) - 940601..941215 (-) 615 WP_000354305.1 DUF4355 domain-containing protein -
  E3S64_RS04670 (E3S64_04670) - 941350..941520 (-) 171 WP_000072207.1 hypothetical protein -
  E3S64_RS04675 (E3S64_04675) - 941593..942588 (-) 996 WP_001133043.1 minor capsid protein -
  E3S64_RS04680 (E3S64_04680) - 942595..944130 (-) 1536 WP_000921883.1 phage portal protein -
  E3S64_RS04685 (E3S64_04685) - 944141..945418 (-) 1278 WP_009560330.1 PBSX family phage terminase large subunit -
  E3S64_RS04690 (E3S64_04690) - 945405..945845 (-) 441 WP_009560332.1 terminase small subunit -
  E3S64_RS04695 (E3S64_04695) - 946033..946455 (-) 423 WP_000162696.1 RinA family phage transcriptional activator -
  E3S64_RS04700 (E3S64_04700) - 946479..946625 (-) 147 WP_009560343.1 hypothetical protein -
  E3S64_RS04705 (E3S64_04705) rinB 946626..946799 (-) 174 WP_064128247.1 transcriptional activator RinB -
  E3S64_RS04710 (E3S64_04710) - 946802..947002 (-) 201 WP_001125016.1 hypothetical protein -
  E3S64_RS04715 (E3S64_04715) - 946977..947165 (-) 189 WP_000195782.1 DUF1381 domain-containing protein -
  E3S64_RS04720 (E3S64_04720) - 947202..947732 (-) 531 WP_000185662.1 dUTPase -
  E3S64_RS04725 (E3S64_04725) - 947725..947973 (-) 249 WP_160199662.1 DUF1024 family protein -
  E3S64_RS04730 (E3S64_04730) - 947966..948331 (-) 366 WP_031765535.1 hypothetical protein -
  E3S64_RS04735 (E3S64_04735) - 948328..948729 (-) 402 WP_000695766.1 hypothetical protein -
  E3S64_RS04740 (E3S64_04740) - 948742..948984 (-) 243 WP_000131366.1 SAV1978 family virulence-associated passenger protein -
  E3S64_RS04745 (E3S64_04745) - 948988..949356 (-) 369 WP_000101274.1 SA1788 family PVL leukocidin-associated protein -
  E3S64_RS04750 (E3S64_04750) - 949369..949773 (-) 405 WP_000401960.1 RusA family crossover junction endodeoxyribonuclease -
  E3S64_RS04755 (E3S64_04755) - 949782..950000 (-) 219 WP_000338528.1 hypothetical protein -
  E3S64_RS04760 (E3S64_04760) - 950007..950891 (-) 885 WP_000148301.1 DnaD domain protein -
  E3S64_RS04765 (E3S64_04765) ssbA 950921..951391 (-) 471 WP_000934770.1 single-stranded DNA-binding protein Machinery gene
  E3S64_RS04770 (E3S64_04770) - 951392..952009 (-) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  E3S64_RS04775 (E3S64_04775) - 952090..953010 (-) 921 WP_000138481.1 recombinase RecT -
  E3S64_RS04780 (E3S64_04780) - 953012..954955 (-) 1944 WP_000700562.1 AAA family ATPase -
  E3S64_RS04785 (E3S64_04785) - 954964..955227 (-) 264 WP_001205732.1 hypothetical protein -
  E3S64_RS04790 (E3S64_04790) - 955236..955496 (-) 261 WP_000291090.1 DUF1108 family protein -
  E3S64_RS04795 (E3S64_04795) - 955590..955751 (-) 162 WP_000066026.1 DUF1270 family protein -
  E3S64_RS14635 - 955744..955872 (-) 129 WP_001559112.1 hypothetical protein -
  E3S64_RS04800 (E3S64_04800) - 955931..956161 (+) 231 WP_000395457.1 hypothetical protein -
  E3S64_RS14490 - 956136..956312 (-) 177 WP_001094935.1 hypothetical protein -
  E3S64_RS04805 (E3S64_04805) - 956365..956559 (-) 195 WP_000390105.1 hypothetical protein -
  E3S64_RS04810 (E3S64_04810) - 956576..957364 (-) 789 WP_001148566.1 phage antirepressor -
  E3S64_RS04815 (E3S64_04815) - 957380..957598 (-) 219 WP_001198672.1 helix-turn-helix transcriptional regulator -
  E3S64_RS04820 (E3S64_04820) - 957740..958459 (+) 720 WP_000358224.1 XRE family transcriptional regulator -
  E3S64_RS04825 (E3S64_04825) - 958495..959427 (+) 933 WP_000392186.1 hypothetical protein -
  E3S64_RS04830 (E3S64_04830) - 959407..959586 (-) 180 WP_000337826.1 hypothetical protein -
  E3S64_RS04835 (E3S64_04835) - 959695..961080 (+) 1386 WP_000861313.1 recombinase family protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17713.63 Da        Isoelectric Point: 5.2672

>NTDB_id=418021 E3S64_RS04765 WP_000934770.1 950921..951391(-) (ssbA) [Staphylococcus aureus strain UP_1322]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=418021 E3S64_RS04765 WP_000934770.1 950921..951391(-) (ssbA) [Staphylococcus aureus strain UP_1322]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment