Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | E3S80_RS13940 | Genome accession | NZ_CP047847 |
| Coordinates | 2776105..2776575 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934770.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain UP_522 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2736821..2781097 | 2776105..2776575 | within | 0 |
Gene organization within MGE regions
Location: 2736821..2781097
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E3S80_RS13700 (E3S80_13700) | - | 2736821..2737447 (-) | 627 | WP_000522384.1 | nitroreductase family protein | - |
| E3S80_RS13705 (E3S80_13705) | - | 2737644..2738903 (+) | 1260 | WP_160199398.1 | SdrH family protein | - |
| E3S80_RS13710 (E3S80_13710) | mroQ | 2738928..2739671 (-) | 744 | WP_000197635.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| E3S80_RS13715 (E3S80_13715) | groES | 2739846..2740130 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| E3S80_RS13720 (E3S80_13720) | groL | 2740206..2741822 (+) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| E3S80_RS13725 (E3S80_13725) | - | 2741891..2743063 (-) | 1173 | WP_031912621.1 | site-specific integrase | - |
| E3S80_RS13730 (E3S80_13730) | - | 2743073..2743696 (-) | 624 | WP_049949256.1 | helix-turn-helix domain-containing protein | - |
| E3S80_RS13735 (E3S80_13735) | - | 2743829..2744086 (+) | 258 | WP_049949255.1 | helix-turn-helix transcriptional regulator | - |
| E3S80_RS13740 (E3S80_13740) | - | 2744067..2744708 (+) | 642 | WP_031912618.1 | Bro-N domain-containing protein | - |
| E3S80_RS13745 (E3S80_13745) | - | 2744722..2745039 (+) | 318 | WP_031912617.1 | helix-turn-helix domain-containing protein | - |
| E3S80_RS14155 | - | 2745036..2745182 (+) | 147 | WP_162852058.1 | hypothetical protein | - |
| E3S80_RS13750 (E3S80_13750) | tscA | 2745175..2745399 (+) | 225 | WP_031912616.1 | type II toxin-antitoxin system antitoxin TscA | - |
| E3S80_RS13755 (E3S80_13755) | tscT | 2745400..2745699 (+) | 300 | WP_001103961.1 | type II toxin-antitoxin system toxin TscT | - |
| E3S80_RS13760 (E3S80_13760) | - | 2745791..2748154 (+) | 2364 | WP_141060971.1 | phage/plasmid primase, P4 family | - |
| E3S80_RS13765 (E3S80_13765) | - | 2748575..2748919 (+) | 345 | WP_001081424.1 | hypothetical protein | - |
| E3S80_RS13770 (E3S80_13770) | - | 2749144..2749350 (+) | 207 | WP_047928558.1 | hypothetical protein | - |
| E3S80_RS13775 (E3S80_13775) | - | 2749337..2750395 (+) | 1059 | WP_047928557.1 | phage capsid protein | - |
| E3S80_RS13780 (E3S80_13780) | - | 2750671..2751066 (+) | 396 | WP_224738669.1 | pathogenicity island protein | - |
| E3S80_RS14400 (E3S80_13785) | - | 2751069..2751210 (+) | 142 | Protein_2686 | terminase small subunit | - |
| E3S80_RS14300 | - | 2751257..2751340 (+) | 84 | Protein_2687 | terminase small subunit | - |
| E3S80_RS13790 (E3S80_13790) | - | 2751487..2752455 (+) | 969 | WP_000801979.1 | Abi family protein | - |
| E3S80_RS14165 (E3S80_13795) | - | 2752680..2752874 (+) | 195 | WP_001834088.1 | hypothetical protein | - |
| E3S80_RS14405 | - | 2752945..2753061 (+) | 117 | Protein_2690 | hypothetical protein | - |
| E3S80_RS13800 (E3S80_13800) | seb | 2753612..2754412 (+) | 801 | WP_031792985.1 | staphylococcal enterotoxin type B | - |
| E3S80_RS13805 (E3S80_13805) | - | 2754490..2755047 (-) | 558 | WP_001035619.1 | DUF4888 domain-containing protein | - |
| E3S80_RS13810 (E3S80_13810) | - | 2756688..2757995 (-) | 1308 | WP_001045078.1 | TrkH family potassium uptake protein | - |
| E3S80_RS13815 (E3S80_13815) | - | 2758156..2759067 (+) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| E3S80_RS13820 (E3S80_13820) | - | 2759129..2759974 (+) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| E3S80_RS13825 (E3S80_13825) | - | 2760346..2761569 (-) | 1224 | WP_000206640.1 | ArgE/DapE family deacylase | - |
| E3S80_RS13830 (E3S80_13830) | lukH | 2762004..2763059 (+) | 1056 | WP_031588767.1 | bi-component leukocidin LukGH subunit H | - |
| E3S80_RS13835 (E3S80_13835) | lukG | 2763081..2764097 (+) | 1017 | WP_000595394.1 | bi-component leukocidin LukGH subunit G | - |
| E3S80_RS13840 (E3S80_13840) | sph | 2764335..2765159 (-) | 825 | Protein_2699 | sphingomyelin phosphodiesterase | - |
| E3S80_RS13845 (E3S80_13845) | - | 2765216..2766253 (-) | 1038 | WP_000857176.1 | tyrosine-type recombinase/integrase | - |
| E3S80_RS13850 (E3S80_13850) | - | 2766361..2766975 (+) | 615 | WP_000191460.1 | hypothetical protein | - |
| E3S80_RS13855 (E3S80_13855) | - | 2766972..2767118 (-) | 147 | WP_001013104.1 | hypothetical protein | - |
| E3S80_RS13860 (E3S80_13860) | - | 2767154..2767336 (-) | 183 | WP_000694772.1 | hypothetical protein | - |
| E3S80_RS13865 (E3S80_13865) | - | 2767536..2768306 (-) | 771 | WP_001208482.1 | S24 family peptidase | - |
| E3S80_RS13870 (E3S80_13870) | - | 2768465..2768689 (+) | 225 | WP_000338186.1 | DUF739 family protein | - |
| E3S80_RS13875 (E3S80_13875) | - | 2768707..2768967 (+) | 261 | WP_000435341.1 | transcriptional regulator | - |
| E3S80_RS13880 (E3S80_13880) | - | 2768991..2769530 (-) | 540 | WP_000351243.1 | hypothetical protein | - |
| E3S80_RS13885 (E3S80_13885) | - | 2769587..2770339 (+) | 753 | WP_024928163.1 | phage antirepressor KilAC domain-containing protein | - |
| E3S80_RS13890 (E3S80_13890) | - | 2770355..2770552 (+) | 198 | Protein_2709 | hypothetical protein | - |
| E3S80_RS13895 (E3S80_13895) | - | 2770583..2770723 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| E3S80_RS13900 (E3S80_13900) | - | 2770738..2771370 (-) | 633 | WP_000275058.1 | hypothetical protein | - |
| E3S80_RS13905 (E3S80_13905) | - | 2771429..2771749 (+) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| E3S80_RS13910 (E3S80_13910) | - | 2771746..2771907 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| E3S80_RS13915 (E3S80_13915) | - | 2772000..2772260 (+) | 261 | WP_047928555.1 | DUF1108 family protein | - |
| E3S80_RS13920 (E3S80_13920) | - | 2772269..2772532 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| E3S80_RS13925 (E3S80_13925) | - | 2772541..2774484 (+) | 1944 | WP_000700557.1 | AAA family ATPase | - |
| E3S80_RS13930 (E3S80_13930) | - | 2774486..2775406 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| E3S80_RS13935 (E3S80_13935) | - | 2775487..2776104 (+) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| E3S80_RS13940 (E3S80_13940) | ssbA | 2776105..2776575 (+) | 471 | WP_000934770.1 | single-stranded DNA-binding protein | Machinery gene |
| E3S80_RS13945 (E3S80_13945) | - | 2776605..2777489 (+) | 885 | WP_000148301.1 | DnaD domain protein | - |
| E3S80_RS13950 (E3S80_13950) | - | 2777496..2777714 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| E3S80_RS13955 (E3S80_13955) | - | 2777723..2778127 (+) | 405 | WP_000401964.1 | RusA family crossover junction endodeoxyribonuclease | - |
| E3S80_RS13960 (E3S80_13960) | - | 2778140..2778511 (+) | 372 | WP_031929144.1 | SA1788 family PVL leukocidin-associated protein | - |
| E3S80_RS13965 (E3S80_13965) | - | 2778512..2778760 (+) | 249 | WP_001126836.1 | phi PVL orf 51-like protein | - |
| E3S80_RS13970 (E3S80_13970) | - | 2778825..2779274 (+) | 450 | WP_000982708.1 | YopX family protein | - |
| E3S80_RS13975 (E3S80_13975) | - | 2779328..2779555 (+) | 228 | Protein_2726 | hypothetical protein | - |
| E3S80_RS13980 (E3S80_13980) | - | 2779548..2779802 (+) | 255 | WP_000370292.1 | DUF1024 family protein | - |
| E3S80_RS13985 (E3S80_13985) | - | 2779922..2780122 (+) | 201 | WP_000265042.1 | DUF1514 family protein | - |
| E3S80_RS13990 (E3S80_13990) | - | 2780150..2780566 (+) | 417 | WP_000590124.1 | hypothetical protein | - |
| E3S80_RS13995 (E3S80_13995) | - | 2780798..2781097 (+) | 300 | WP_000988332.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17713.63 Da Isoelectric Point: 5.2672
>NTDB_id=417744 E3S80_RS13940 WP_000934770.1 2776105..2776575(+) (ssbA) [Staphylococcus aureus strain UP_522]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=417744 E3S80_RS13940 WP_000934770.1 2776105..2776575(+) (ssbA) [Staphylococcus aureus strain UP_522]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |