Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | E3S84_RS13600 | Genome accession | NZ_CP047841 |
| Coordinates | 2733349..2733819 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934770.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain UP_644 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2694065..2738341 | 2733349..2733819 | within | 0 |
Gene organization within MGE regions
Location: 2694065..2738341
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E3S84_RS13360 (E3S84_13360) | - | 2694065..2694691 (-) | 627 | WP_000522384.1 | nitroreductase family protein | - |
| E3S84_RS13365 (E3S84_13365) | - | 2694888..2696147 (+) | 1260 | WP_031588341.1 | SdrH family protein | - |
| E3S84_RS13370 (E3S84_13370) | mroQ | 2696172..2696915 (-) | 744 | WP_000197635.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| E3S84_RS13375 (E3S84_13375) | groES | 2697090..2697374 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| E3S84_RS13380 (E3S84_13380) | groL | 2697450..2699066 (+) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| E3S84_RS13385 (E3S84_13385) | - | 2699135..2700307 (-) | 1173 | WP_031912621.1 | site-specific integrase | - |
| E3S84_RS13390 (E3S84_13390) | - | 2700317..2700940 (-) | 624 | WP_049949256.1 | helix-turn-helix domain-containing protein | - |
| E3S84_RS13395 (E3S84_13395) | - | 2701073..2701330 (+) | 258 | WP_049949255.1 | helix-turn-helix transcriptional regulator | - |
| E3S84_RS13400 (E3S84_13400) | - | 2701311..2701952 (+) | 642 | WP_031912618.1 | Bro-N domain-containing protein | - |
| E3S84_RS13405 (E3S84_13405) | - | 2701966..2702283 (+) | 318 | WP_031912617.1 | helix-turn-helix domain-containing protein | - |
| E3S84_RS13800 | - | 2702280..2702426 (+) | 147 | WP_162852058.1 | hypothetical protein | - |
| E3S84_RS13410 (E3S84_13410) | tscA | 2702419..2702643 (+) | 225 | WP_031912616.1 | type II toxin-antitoxin system antitoxin TscA | - |
| E3S84_RS13415 (E3S84_13415) | tscT | 2702644..2702943 (+) | 300 | WP_001103961.1 | type II toxin-antitoxin system toxin TscT | - |
| E3S84_RS13420 (E3S84_13420) | - | 2703035..2705398 (+) | 2364 | WP_141060971.1 | phage/plasmid primase, P4 family | - |
| E3S84_RS13425 (E3S84_13425) | - | 2705819..2706163 (+) | 345 | WP_001081424.1 | hypothetical protein | - |
| E3S84_RS13430 (E3S84_13430) | - | 2706388..2706594 (+) | 207 | WP_047928558.1 | hypothetical protein | - |
| E3S84_RS13435 (E3S84_13435) | - | 2706581..2707639 (+) | 1059 | WP_047928557.1 | phage capsid protein | - |
| E3S84_RS13440 (E3S84_13440) | - | 2707915..2708310 (+) | 396 | WP_224738669.1 | pathogenicity island protein | - |
| E3S84_RS14035 (E3S84_13445) | - | 2708313..2708454 (+) | 142 | Protein_2610 | terminase small subunit | - |
| E3S84_RS13940 | - | 2708501..2708584 (+) | 84 | Protein_2611 | terminase small subunit | - |
| E3S84_RS13450 (E3S84_13450) | - | 2708731..2709699 (+) | 969 | WP_000801979.1 | Abi family protein | - |
| E3S84_RS13810 (E3S84_13455) | - | 2709924..2710118 (+) | 195 | WP_001834088.1 | hypothetical protein | - |
| E3S84_RS13945 | - | 2710189..2710305 (+) | 117 | Protein_2614 | hypothetical protein | - |
| E3S84_RS13460 (E3S84_13460) | seb | 2710856..2711656 (+) | 801 | WP_031792985.1 | staphylococcal enterotoxin type B | - |
| E3S84_RS13465 (E3S84_13465) | - | 2711734..2712291 (-) | 558 | WP_001035619.1 | DUF4888 domain-containing protein | - |
| E3S84_RS13470 (E3S84_13470) | - | 2713932..2715239 (-) | 1308 | WP_001045078.1 | TrkH family potassium uptake protein | - |
| E3S84_RS13475 (E3S84_13475) | - | 2715400..2716311 (+) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| E3S84_RS13480 (E3S84_13480) | - | 2716373..2717218 (+) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| E3S84_RS13485 (E3S84_13485) | - | 2717590..2718813 (-) | 1224 | WP_000206640.1 | ArgE/DapE family deacylase | - |
| E3S84_RS13490 (E3S84_13490) | lukH | 2719248..2720303 (+) | 1056 | WP_031588767.1 | bi-component leukocidin LukGH subunit H | - |
| E3S84_RS13495 (E3S84_13495) | lukG | 2720325..2721341 (+) | 1017 | WP_000595394.1 | bi-component leukocidin LukGH subunit G | - |
| E3S84_RS13500 (E3S84_13500) | sph | 2721579..2722403 (-) | 825 | Protein_2623 | sphingomyelin phosphodiesterase | - |
| E3S84_RS13505 (E3S84_13505) | - | 2722460..2723497 (-) | 1038 | WP_000857176.1 | tyrosine-type recombinase/integrase | - |
| E3S84_RS13510 (E3S84_13510) | - | 2723605..2724219 (+) | 615 | WP_000191460.1 | hypothetical protein | - |
| E3S84_RS13515 (E3S84_13515) | - | 2724216..2724362 (-) | 147 | WP_001013104.1 | hypothetical protein | - |
| E3S84_RS13520 (E3S84_13520) | - | 2724398..2724580 (-) | 183 | WP_000694772.1 | hypothetical protein | - |
| E3S84_RS13525 (E3S84_13525) | - | 2724780..2725550 (-) | 771 | WP_001208482.1 | S24 family peptidase | - |
| E3S84_RS13530 (E3S84_13530) | - | 2725709..2725933 (+) | 225 | WP_000338186.1 | DUF739 family protein | - |
| E3S84_RS13535 (E3S84_13535) | - | 2725951..2726211 (+) | 261 | WP_000435341.1 | transcriptional regulator | - |
| E3S84_RS13540 (E3S84_13540) | - | 2726235..2726774 (-) | 540 | WP_000351243.1 | hypothetical protein | - |
| E3S84_RS13545 (E3S84_13545) | - | 2726831..2727583 (+) | 753 | WP_024928163.1 | phage antirepressor KilAC domain-containing protein | - |
| E3S84_RS13550 (E3S84_13550) | - | 2727599..2727796 (+) | 198 | Protein_2633 | hypothetical protein | - |
| E3S84_RS13555 (E3S84_13555) | - | 2727827..2727967 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| E3S84_RS13560 (E3S84_13560) | - | 2727982..2728614 (-) | 633 | WP_000275058.1 | hypothetical protein | - |
| E3S84_RS13565 (E3S84_13565) | - | 2728673..2728993 (+) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| E3S84_RS13570 (E3S84_13570) | - | 2728990..2729151 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| E3S84_RS13575 (E3S84_13575) | - | 2729244..2729504 (+) | 261 | WP_047928555.1 | DUF1108 family protein | - |
| E3S84_RS13580 (E3S84_13580) | - | 2729513..2729776 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| E3S84_RS13585 (E3S84_13585) | - | 2729785..2731728 (+) | 1944 | WP_000700557.1 | AAA family ATPase | - |
| E3S84_RS13590 (E3S84_13590) | - | 2731730..2732650 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| E3S84_RS13595 (E3S84_13595) | - | 2732731..2733348 (+) | 618 | WP_236658089.1 | MBL fold metallo-hydrolase | - |
| E3S84_RS13600 (E3S84_13600) | ssbA | 2733349..2733819 (+) | 471 | WP_000934770.1 | single-stranded DNA-binding protein | Machinery gene |
| E3S84_RS13605 (E3S84_13605) | - | 2733849..2734733 (+) | 885 | WP_000148301.1 | DnaD domain protein | - |
| E3S84_RS13610 (E3S84_13610) | - | 2734740..2734958 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| E3S84_RS13615 (E3S84_13615) | - | 2734967..2735371 (+) | 405 | WP_000401964.1 | RusA family crossover junction endodeoxyribonuclease | - |
| E3S84_RS13620 (E3S84_13620) | - | 2735384..2735755 (+) | 372 | WP_031929144.1 | SA1788 family PVL leukocidin-associated protein | - |
| E3S84_RS13625 (E3S84_13625) | - | 2735756..2736004 (+) | 249 | WP_001126836.1 | phi PVL orf 51-like protein | - |
| E3S84_RS13630 (E3S84_13630) | - | 2736069..2736518 (+) | 450 | WP_000982708.1 | YopX family protein | - |
| E3S84_RS13635 (E3S84_13635) | - | 2736572..2736799 (+) | 228 | Protein_2650 | hypothetical protein | - |
| E3S84_RS13640 (E3S84_13640) | - | 2736792..2737046 (+) | 255 | WP_000370292.1 | DUF1024 family protein | - |
| E3S84_RS13645 (E3S84_13645) | - | 2737166..2737366 (+) | 201 | WP_000265042.1 | DUF1514 family protein | - |
| E3S84_RS13650 (E3S84_13650) | - | 2737394..2737810 (+) | 417 | WP_000590124.1 | hypothetical protein | - |
| E3S84_RS13655 (E3S84_13655) | - | 2738042..2738341 (+) | 300 | WP_000988332.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17713.63 Da Isoelectric Point: 5.2672
>NTDB_id=417618 E3S84_RS13600 WP_000934770.1 2733349..2733819(+) (ssbA) [Staphylococcus aureus strain UP_644]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=417618 E3S84_RS13600 WP_000934770.1 2733349..2733819(+) (ssbA) [Staphylococcus aureus strain UP_644]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |