Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   E3S84_RS13600 Genome accession   NZ_CP047841
Coordinates   2733349..2733819 (+) Length   156 a.a.
NCBI ID   WP_000934770.1    Uniprot ID   -
Organism   Staphylococcus aureus strain UP_644     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2694065..2738341 2733349..2733819 within 0


Gene organization within MGE regions


Location: 2694065..2738341
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  E3S84_RS13360 (E3S84_13360) - 2694065..2694691 (-) 627 WP_000522384.1 nitroreductase family protein -
  E3S84_RS13365 (E3S84_13365) - 2694888..2696147 (+) 1260 WP_031588341.1 SdrH family protein -
  E3S84_RS13370 (E3S84_13370) mroQ 2696172..2696915 (-) 744 WP_000197635.1 CPBP family intramembrane glutamic endopeptidase MroQ -
  E3S84_RS13375 (E3S84_13375) groES 2697090..2697374 (+) 285 WP_000917289.1 co-chaperone GroES -
  E3S84_RS13380 (E3S84_13380) groL 2697450..2699066 (+) 1617 WP_000240642.1 chaperonin GroEL -
  E3S84_RS13385 (E3S84_13385) - 2699135..2700307 (-) 1173 WP_031912621.1 site-specific integrase -
  E3S84_RS13390 (E3S84_13390) - 2700317..2700940 (-) 624 WP_049949256.1 helix-turn-helix domain-containing protein -
  E3S84_RS13395 (E3S84_13395) - 2701073..2701330 (+) 258 WP_049949255.1 helix-turn-helix transcriptional regulator -
  E3S84_RS13400 (E3S84_13400) - 2701311..2701952 (+) 642 WP_031912618.1 Bro-N domain-containing protein -
  E3S84_RS13405 (E3S84_13405) - 2701966..2702283 (+) 318 WP_031912617.1 helix-turn-helix domain-containing protein -
  E3S84_RS13800 - 2702280..2702426 (+) 147 WP_162852058.1 hypothetical protein -
  E3S84_RS13410 (E3S84_13410) tscA 2702419..2702643 (+) 225 WP_031912616.1 type II toxin-antitoxin system antitoxin TscA -
  E3S84_RS13415 (E3S84_13415) tscT 2702644..2702943 (+) 300 WP_001103961.1 type II toxin-antitoxin system toxin TscT -
  E3S84_RS13420 (E3S84_13420) - 2703035..2705398 (+) 2364 WP_141060971.1 phage/plasmid primase, P4 family -
  E3S84_RS13425 (E3S84_13425) - 2705819..2706163 (+) 345 WP_001081424.1 hypothetical protein -
  E3S84_RS13430 (E3S84_13430) - 2706388..2706594 (+) 207 WP_047928558.1 hypothetical protein -
  E3S84_RS13435 (E3S84_13435) - 2706581..2707639 (+) 1059 WP_047928557.1 phage capsid protein -
  E3S84_RS13440 (E3S84_13440) - 2707915..2708310 (+) 396 WP_224738669.1 pathogenicity island protein -
  E3S84_RS14035 (E3S84_13445) - 2708313..2708454 (+) 142 Protein_2610 terminase small subunit -
  E3S84_RS13940 - 2708501..2708584 (+) 84 Protein_2611 terminase small subunit -
  E3S84_RS13450 (E3S84_13450) - 2708731..2709699 (+) 969 WP_000801979.1 Abi family protein -
  E3S84_RS13810 (E3S84_13455) - 2709924..2710118 (+) 195 WP_001834088.1 hypothetical protein -
  E3S84_RS13945 - 2710189..2710305 (+) 117 Protein_2614 hypothetical protein -
  E3S84_RS13460 (E3S84_13460) seb 2710856..2711656 (+) 801 WP_031792985.1 staphylococcal enterotoxin type B -
  E3S84_RS13465 (E3S84_13465) - 2711734..2712291 (-) 558 WP_001035619.1 DUF4888 domain-containing protein -
  E3S84_RS13470 (E3S84_13470) - 2713932..2715239 (-) 1308 WP_001045078.1 TrkH family potassium uptake protein -
  E3S84_RS13475 (E3S84_13475) - 2715400..2716311 (+) 912 WP_000825510.1 iron-hydroxamate ABC transporter substrate-binding protein -
  E3S84_RS13480 (E3S84_13480) - 2716373..2717218 (+) 846 WP_000812008.1 class I SAM-dependent methyltransferase -
  E3S84_RS13485 (E3S84_13485) - 2717590..2718813 (-) 1224 WP_000206640.1 ArgE/DapE family deacylase -
  E3S84_RS13490 (E3S84_13490) lukH 2719248..2720303 (+) 1056 WP_031588767.1 bi-component leukocidin LukGH subunit H -
  E3S84_RS13495 (E3S84_13495) lukG 2720325..2721341 (+) 1017 WP_000595394.1 bi-component leukocidin LukGH subunit G -
  E3S84_RS13500 (E3S84_13500) sph 2721579..2722403 (-) 825 Protein_2623 sphingomyelin phosphodiesterase -
  E3S84_RS13505 (E3S84_13505) - 2722460..2723497 (-) 1038 WP_000857176.1 tyrosine-type recombinase/integrase -
  E3S84_RS13510 (E3S84_13510) - 2723605..2724219 (+) 615 WP_000191460.1 hypothetical protein -
  E3S84_RS13515 (E3S84_13515) - 2724216..2724362 (-) 147 WP_001013104.1 hypothetical protein -
  E3S84_RS13520 (E3S84_13520) - 2724398..2724580 (-) 183 WP_000694772.1 hypothetical protein -
  E3S84_RS13525 (E3S84_13525) - 2724780..2725550 (-) 771 WP_001208482.1 S24 family peptidase -
  E3S84_RS13530 (E3S84_13530) - 2725709..2725933 (+) 225 WP_000338186.1 DUF739 family protein -
  E3S84_RS13535 (E3S84_13535) - 2725951..2726211 (+) 261 WP_000435341.1 transcriptional regulator -
  E3S84_RS13540 (E3S84_13540) - 2726235..2726774 (-) 540 WP_000351243.1 hypothetical protein -
  E3S84_RS13545 (E3S84_13545) - 2726831..2727583 (+) 753 WP_024928163.1 phage antirepressor KilAC domain-containing protein -
  E3S84_RS13550 (E3S84_13550) - 2727599..2727796 (+) 198 Protein_2633 hypothetical protein -
  E3S84_RS13555 (E3S84_13555) - 2727827..2727967 (+) 141 WP_000939496.1 hypothetical protein -
  E3S84_RS13560 (E3S84_13560) - 2727982..2728614 (-) 633 WP_000275058.1 hypothetical protein -
  E3S84_RS13565 (E3S84_13565) - 2728673..2728993 (+) 321 WP_001120197.1 DUF771 domain-containing protein -
  E3S84_RS13570 (E3S84_13570) - 2728990..2729151 (+) 162 WP_000066020.1 DUF1270 domain-containing protein -
  E3S84_RS13575 (E3S84_13575) - 2729244..2729504 (+) 261 WP_047928555.1 DUF1108 family protein -
  E3S84_RS13580 (E3S84_13580) - 2729513..2729776 (+) 264 WP_001205732.1 hypothetical protein -
  E3S84_RS13585 (E3S84_13585) - 2729785..2731728 (+) 1944 WP_000700557.1 AAA family ATPase -
  E3S84_RS13590 (E3S84_13590) - 2731730..2732650 (+) 921 WP_000138475.1 recombinase RecT -
  E3S84_RS13595 (E3S84_13595) - 2732731..2733348 (+) 618 WP_236658089.1 MBL fold metallo-hydrolase -
  E3S84_RS13600 (E3S84_13600) ssbA 2733349..2733819 (+) 471 WP_000934770.1 single-stranded DNA-binding protein Machinery gene
  E3S84_RS13605 (E3S84_13605) - 2733849..2734733 (+) 885 WP_000148301.1 DnaD domain protein -
  E3S84_RS13610 (E3S84_13610) - 2734740..2734958 (+) 219 WP_000338528.1 hypothetical protein -
  E3S84_RS13615 (E3S84_13615) - 2734967..2735371 (+) 405 WP_000401964.1 RusA family crossover junction endodeoxyribonuclease -
  E3S84_RS13620 (E3S84_13620) - 2735384..2735755 (+) 372 WP_031929144.1 SA1788 family PVL leukocidin-associated protein -
  E3S84_RS13625 (E3S84_13625) - 2735756..2736004 (+) 249 WP_001126836.1 phi PVL orf 51-like protein -
  E3S84_RS13630 (E3S84_13630) - 2736069..2736518 (+) 450 WP_000982708.1 YopX family protein -
  E3S84_RS13635 (E3S84_13635) - 2736572..2736799 (+) 228 Protein_2650 hypothetical protein -
  E3S84_RS13640 (E3S84_13640) - 2736792..2737046 (+) 255 WP_000370292.1 DUF1024 family protein -
  E3S84_RS13645 (E3S84_13645) - 2737166..2737366 (+) 201 WP_000265042.1 DUF1514 family protein -
  E3S84_RS13650 (E3S84_13650) - 2737394..2737810 (+) 417 WP_000590124.1 hypothetical protein -
  E3S84_RS13655 (E3S84_13655) - 2738042..2738341 (+) 300 WP_000988332.1 HNH endonuclease -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17713.63 Da        Isoelectric Point: 5.2672

>NTDB_id=417618 E3S84_RS13600 WP_000934770.1 2733349..2733819(+) (ssbA) [Staphylococcus aureus strain UP_644]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=417618 E3S84_RS13600 WP_000934770.1 2733349..2733819(+) (ssbA) [Staphylococcus aureus strain UP_644]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment