Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   E3T02_RS13940 Genome accession   NZ_CP047822
Coordinates   2809010..2809480 (+) Length   156 a.a.
NCBI ID   WP_000934769.1    Uniprot ID   -
Organism   Staphylococcus aureus strain UP_1278     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2785172..2816129 2809010..2809480 within 0


Gene organization within MGE regions


Location: 2785172..2816129
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  E3T02_RS13780 (E3T02_13780) groES 2785172..2785456 (+) 285 WP_000917289.1 co-chaperone GroES -
  E3T02_RS13785 (E3T02_13785) groL 2785532..2787148 (+) 1617 WP_000240642.1 chaperonin GroEL -
  E3T02_RS13790 (E3T02_13790) - 2787685..2787864 (+) 180 WP_000201397.1 hypothetical protein -
  E3T02_RS13795 (E3T02_13795) - 2787861..2788487 (+) 627 WP_000216894.1 hypothetical protein -
  E3T02_RS13800 (E3T02_13800) - 2789060..2790367 (-) 1308 WP_045174153.1 TrkH family potassium uptake protein -
  E3T02_RS13805 (E3T02_13805) - 2790528..2791439 (+) 912 WP_000825510.1 iron-hydroxamate ABC transporter substrate-binding protein -
  E3T02_RS13810 (E3T02_13810) - 2791501..2792345 (+) 845 Protein_2678 class I SAM-dependent methyltransferase -
  E3T02_RS13815 (E3T02_13815) - 2792717..2793940 (-) 1224 WP_000206623.1 ArgE/DapE family deacylase -
  E3T02_RS13820 (E3T02_13820) lukH 2794376..2795428 (+) 1053 WP_000791404.1 bi-component leukocidin LukGH subunit H -
  E3T02_RS13825 (E3T02_13825) lukG 2795450..2796466 (+) 1017 WP_000595401.1 bi-component leukocidin LukGH subunit G -
  E3T02_RS13830 (E3T02_13830) sph 2796704..2797528 (-) 825 Protein_2682 sphingomyelin phosphodiesterase -
  E3T02_RS13835 (E3T02_13835) - 2797585..2798622 (-) 1038 WP_000857198.1 tyrosine-type recombinase/integrase -
  E3T02_RS13840 (E3T02_13840) - 2798681..2799145 (-) 465 WP_000825947.1 hypothetical protein -
  E3T02_RS13845 (E3T02_13845) - 2799245..2799427 (-) 183 WP_000705248.1 hypothetical protein -
  E3T02_RS13850 (E3T02_13850) - 2799631..2799972 (-) 342 WP_000591749.1 hypothetical protein -
  E3T02_RS13855 (E3T02_13855) - 2799978..2800910 (-) 933 WP_000759682.1 exonuclease domain-containing protein -
  E3T02_RS13860 (E3T02_13860) - 2800926..2801639 (-) 714 WP_001031454.1 XRE family transcriptional regulator -
  E3T02_RS13865 (E3T02_13865) - 2801602..2801775 (+) 174 WP_001801500.1 hypothetical protein -
  E3T02_RS13870 (E3T02_13870) - 2801772..2802035 (+) 264 WP_061823675.1 helix-turn-helix transcriptional regulator -
  E3T02_RS13875 (E3T02_13875) - 2802051..2802266 (+) 216 WP_001025404.1 Thoeris anti-defense Tad2 family protein -
  E3T02_RS13880 (E3T02_13880) - 2802255..2802584 (-) 330 WP_000128907.1 hypothetical protein -
  E3T02_RS13885 (E3T02_13885) - 2802635..2803387 (+) 753 WP_001148605.1 phage antirepressor KilAC domain-containing protein -
  E3T02_RS13890 (E3T02_13890) - 2803403..2803600 (+) 198 WP_001148862.1 hypothetical protein -
  E3T02_RS13895 (E3T02_13895) - 2803587..2803967 (-) 381 WP_000762521.1 DUF2513 domain-containing protein -
  E3T02_RS13900 (E3T02_13900) - 2804022..2804345 (+) 324 WP_061823677.1 DUF771 domain-containing protein -
  E3T02_RS13905 (E3T02_13905) - 2804342..2804503 (+) 162 WP_000048129.1 DUF1270 family protein -
  E3T02_RS13910 (E3T02_13910) - 2804598..2804900 (+) 303 WP_000165371.1 DUF2482 family protein -
  E3T02_RS13915 (E3T02_13915) - 2804905..2805165 (+) 261 WP_000291510.1 DUF1108 family protein -
  E3T02_RS13920 (E3T02_13920) - 2805174..2805437 (+) 264 WP_001205732.1 hypothetical protein -
  E3T02_RS13925 (E3T02_13925) - 2805446..2807389 (+) 1944 Protein_2701 AAA family ATPase -
  E3T02_RS13930 (E3T02_13930) - 2807391..2808311 (+) 921 WP_000138475.1 recombinase RecT -
  E3T02_RS13935 (E3T02_13935) - 2808392..2809009 (+) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  E3T02_RS13940 (E3T02_13940) ssbA 2809010..2809480 (+) 471 WP_000934769.1 single-stranded DNA-binding protein Machinery gene
  E3T02_RS13945 (E3T02_13945) - 2809510..2810403 (+) 894 WP_000148329.1 DnaD domain protein -
  E3T02_RS13950 (E3T02_13950) - 2810410..2810628 (+) 219 WP_000338528.1 hypothetical protein -
  E3T02_RS13955 (E3T02_13955) - 2810637..2811041 (+) 405 WP_000401964.1 RusA family crossover junction endodeoxyribonuclease -
  E3T02_RS13960 (E3T02_13960) - 2811054..2811422 (+) 369 WP_000101270.1 SA1788 family PVL leukocidin-associated protein -
  E3T02_RS13965 (E3T02_13965) - 2811426..2811668 (+) 243 WP_000131377.1 phi PVL orf 51-like protein -
  E3T02_RS13970 (E3T02_13970) - 2811682..2812068 (+) 387 WP_000693615.1 hypothetical protein -
  E3T02_RS14205 - 2812065..2812259 (+) 195 WP_000983954.1 hypothetical protein -
  E3T02_RS13975 (E3T02_13975) - 2812256..2812705 (+) 450 WP_000982708.1 YopX family protein -
  E3T02_RS13980 (E3T02_13980) - 2812702..2812986 (+) 285 WP_001105621.1 hypothetical protein -
  E3T02_RS13985 (E3T02_13985) - 2812979..2813227 (+) 249 WP_001065083.1 DUF1024 family protein -
  E3T02_RS13990 (E3T02_13990) - 2813220..2813756 (+) 537 WP_000185669.1 dUTP diphosphatase -
  E3T02_RS13995 (E3T02_13995) - 2813793..2813999 (+) 207 WP_000195810.1 DUF1381 domain-containing protein -
  E3T02_RS14000 (E3T02_14000) rinB 2813996..2814145 (+) 150 WP_000595267.1 transcriptional activator RinB -
  E3T02_RS14005 (E3T02_14005) - 2814304..2814954 (+) 651 WP_001005262.1 hypothetical protein -
  E3T02_RS14010 (E3T02_14010) - 2814954..2815154 (+) 201 WP_000265043.1 DUF1514 family protein -
  E3T02_RS14015 (E3T02_14015) - 2815182..2815598 (+) 417 WP_000590122.1 hypothetical protein -
  E3T02_RS14020 (E3T02_14020) - 2815830..2816129 (+) 300 WP_000988330.1 HNH endonuclease -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17671.55 Da        Isoelectric Point: 5.2672

>NTDB_id=417284 E3T02_RS13940 WP_000934769.1 2809010..2809480(+) (ssbA) [Staphylococcus aureus strain UP_1278]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=417284 E3T02_RS13940 WP_000934769.1 2809010..2809480(+) (ssbA) [Staphylococcus aureus strain UP_1278]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment