Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | E3S62_RS13850 | Genome accession | NZ_CP047803 |
| Coordinates | 2798216..2798686 (+) | Length | 156 a.a. |
| NCBI ID | WP_000610648.1 | Uniprot ID | A0A090M1W2 |
| Organism | Staphylococcus aureus strain UP_1097 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2773441..2804018 | 2798216..2798686 | within | 0 |
Gene organization within MGE regions
Location: 2773441..2804018
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E3S62_RS13695 (E3S62_13695) | - | 2774742..2775368 (-) | 627 | WP_000522375.1 | nitroreductase family protein | - |
| E3S62_RS13700 (E3S62_13700) | - | 2775565..2776692 (+) | 1128 | WP_073402287.1 | SdrH family protein | - |
| E3S62_RS13705 (E3S62_13705) | mroQ | 2776717..2777460 (-) | 744 | WP_000197627.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| E3S62_RS13710 (E3S62_13710) | groES | 2777635..2777919 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| E3S62_RS13715 (E3S62_13715) | groL | 2777995..2779611 (+) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| E3S62_RS13720 (E3S62_13720) | - | 2780143..2781450 (-) | 1308 | WP_001045070.1 | TrkH family potassium uptake protein | - |
| E3S62_RS13725 (E3S62_13725) | - | 2781903..2783126 (-) | 1224 | WP_000206615.1 | ArgE/DapE family deacylase | - |
| E3S62_RS13730 (E3S62_13730) | - | 2783557..2784612 (+) | 1056 | Protein_2674 | leukocidin family pore-forming toxin | - |
| E3S62_RS13735 (E3S62_13735) | - | 2784634..2785653 (+) | 1020 | WP_000595616.1 | leukocidin/hemolysin toxin family protein | - |
| E3S62_RS13740 (E3S62_13740) | sph | 2785910..2786734 (-) | 825 | Protein_2676 | sphingomyelin phosphodiesterase | - |
| E3S62_RS13745 (E3S62_13745) | - | 2786791..2787828 (-) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| E3S62_RS13750 (E3S62_13750) | - | 2787887..2788351 (-) | 465 | WP_000825947.1 | hypothetical protein | - |
| E3S62_RS13755 (E3S62_13755) | - | 2788451..2788633 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| E3S62_RS13760 (E3S62_13760) | - | 2788837..2789178 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| E3S62_RS13765 (E3S62_13765) | - | 2789184..2790116 (-) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| E3S62_RS13770 (E3S62_13770) | - | 2790132..2790845 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| E3S62_RS13775 (E3S62_13775) | - | 2790808..2790981 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| E3S62_RS13780 (E3S62_13780) | - | 2790978..2791241 (+) | 264 | WP_000854073.1 | helix-turn-helix transcriptional regulator | - |
| E3S62_RS13785 (E3S62_13785) | - | 2791257..2791472 (+) | 216 | WP_001025404.1 | Thoeris anti-defense Tad2 family protein | - |
| E3S62_RS13790 (E3S62_13790) | - | 2791461..2791790 (-) | 330 | WP_000128907.1 | hypothetical protein | - |
| E3S62_RS13795 (E3S62_13795) | - | 2791841..2792593 (+) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| E3S62_RS13800 (E3S62_13800) | - | 2792609..2792806 (+) | 198 | WP_001148862.1 | hypothetical protein | - |
| E3S62_RS13805 (E3S62_13805) | - | 2792793..2793173 (-) | 381 | WP_000762519.1 | DUF2513 domain-containing protein | - |
| E3S62_RS13810 (E3S62_13810) | - | 2793228..2793551 (+) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| E3S62_RS13815 (E3S62_13815) | - | 2793548..2793709 (+) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| E3S62_RS13820 (E3S62_13820) | - | 2793804..2794106 (+) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| E3S62_RS13825 (E3S62_13825) | - | 2794111..2794371 (+) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| E3S62_RS13830 (E3S62_13830) | - | 2794380..2794643 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| E3S62_RS13835 (E3S62_13835) | - | 2794652..2796595 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| E3S62_RS13840 (E3S62_13840) | - | 2796597..2797517 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| E3S62_RS13845 (E3S62_13845) | - | 2797598..2798215 (+) | 618 | WP_073394849.1 | MBL fold metallo-hydrolase | - |
| E3S62_RS13850 (E3S62_13850) | ssbA | 2798216..2798686 (+) | 471 | WP_000610648.1 | single-stranded DNA-binding protein | Machinery gene |
| E3S62_RS13855 (E3S62_13855) | - | 2798716..2799609 (+) | 894 | WP_160199843.1 | DnaD domain protein | - |
| E3S62_RS13860 (E3S62_13860) | - | 2799616..2799834 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| E3S62_RS13865 (E3S62_13865) | - | 2799843..2800247 (+) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| E3S62_RS13870 (E3S62_13870) | - | 2800260..2800628 (+) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| E3S62_RS13875 (E3S62_13875) | - | 2800632..2800874 (+) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| E3S62_RS13880 (E3S62_13880) | - | 2800889..2801143 (+) | 255 | WP_001065097.1 | DUF1024 family protein | - |
| E3S62_RS13980 | - | 2801130..2801300 (+) | 171 | WP_000714403.1 | hypothetical protein | - |
| E3S62_RS13885 (E3S62_13885) | - | 2801293..2801829 (+) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| E3S62_RS13890 (E3S62_13890) | - | 2801866..2802111 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| E3S62_RS13895 (E3S62_13895) | - | 2802108..2802314 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| E3S62_RS13900 (E3S62_13900) | - | 2802311..2802697 (+) | 387 | WP_160200336.1 | hypothetical protein | - |
| E3S62_RS13905 (E3S62_13905) | rinB | 2802694..2802843 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| E3S62_RS13910 (E3S62_13910) | - | 2802843..2803043 (+) | 201 | WP_001622114.1 | DUF1514 family protein | - |
| E3S62_RS13915 (E3S62_13915) | - | 2803071..2803487 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| E3S62_RS13920 (E3S62_13920) | - | 2803719..2804018 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=416865 E3S62_RS13850 WP_000610648.1 2798216..2798686(+) (ssbA) [Staphylococcus aureus strain UP_1097]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=416865 E3S62_RS13850 WP_000610648.1 2798216..2798686(+) (ssbA) [Staphylococcus aureus strain UP_1097]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |