Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   E3S73_RS13910 Genome accession   NZ_CP047799
Coordinates   2816020..2816490 (+) Length   156 a.a.
NCBI ID   WP_000934770.1    Uniprot ID   -
Organism   Staphylococcus aureus strain UP_322     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2794168..2821427 2816020..2816490 within 0


Gene organization within MGE regions


Location: 2794168..2821427
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  E3S73_RS13770 (E3S73_13770) groES 2794168..2794452 (+) 285 WP_000917289.1 co-chaperone GroES -
  E3S73_RS13775 (E3S73_13775) groL 2794528..2796144 (+) 1617 WP_000240651.1 chaperonin GroEL -
  E3S73_RS13780 (E3S73_13780) - 2796686..2796865 (+) 180 WP_000201397.1 hypothetical protein -
  E3S73_RS14150 - 2796862..2797158 (+) 297 WP_001573769.1 hypothetical protein -
  E3S73_RS13785 (E3S73_13785) - 2797148..2797489 (+) 342 WP_001573771.1 hypothetical protein -
  E3S73_RS13790 (E3S73_13790) - 2798067..2799374 (-) 1308 WP_001045073.1 TrkH family potassium uptake protein -
  E3S73_RS13795 (E3S73_13795) - 2799813..2801036 (-) 1224 WP_000206618.1 ArgE/DapE family deacylase -
  E3S73_RS13800 (E3S73_13800) - 2801468..2802523 (+) 1056 WP_000791398.1 leukocidin family pore-forming toxin -
  E3S73_RS13805 (E3S73_13805) - 2802545..2803564 (+) 1020 WP_000595617.1 leukocidin/hemolysin toxin family protein -
  E3S73_RS13810 (E3S73_13810) sph 2803821..2804645 (-) 825 Protein_2691 sphingomyelin phosphodiesterase -
  E3S73_RS13815 (E3S73_13815) - 2804702..2805739 (-) 1038 WP_000857198.1 tyrosine-type recombinase/integrase -
  E3S73_RS13820 (E3S73_13820) - 2805912..2806451 (-) 540 WP_000391618.1 type II toxin-antitoxin system PemK/MazF family toxin -
  E3S73_RS13825 (E3S73_13825) - 2806591..2806758 (-) 168 WP_000705238.1 hypothetical protein -
  E3S73_RS13830 (E3S73_13830) - 2806829..2807014 (-) 186 WP_000109189.1 hypothetical protein -
  E3S73_RS14065 - 2807011..2807157 (-) 147 WP_000345949.1 hypothetical protein -
  E3S73_RS13835 (E3S73_13835) - 2807231..2808085 (-) 855 WP_001557601.1 HIRAN domain-containing protein -
  E3S73_RS13840 (E3S73_13840) - 2808097..2808813 (-) 717 WP_001083975.1 LexA family transcriptional regulator -
  E3S73_RS13845 (E3S73_13845) - 2808977..2809219 (+) 243 WP_000639923.1 DUF739 family protein -
  E3S73_RS13850 (E3S73_13850) - 2809232..2809675 (+) 444 WP_001662741.1 hypothetical protein -
  E3S73_RS13855 (E3S73_13855) - 2809690..2809830 (+) 141 WP_000939495.1 hypothetical protein -
  E3S73_RS13860 (E3S73_13860) - 2809823..2810032 (-) 210 WP_000772137.1 hypothetical protein -
  E3S73_RS13865 (E3S73_13865) - 2810089..2810838 (+) 750 WP_001148337.1 phage antirepressor KilAC domain-containing protein -
  E3S73_RS13870 (E3S73_13870) - 2810851..2811111 (+) 261 WP_000435343.1 hypothetical protein -
  E3S73_RS14155 - 2811135..2811290 (-) 156 Protein_2705 hypothetical protein -
  E3S73_RS13875 (E3S73_13875) - 2811344..2811664 (+) 321 WP_001120936.1 DUF771 domain-containing protein -
  E3S73_RS13880 (E3S73_13880) - 2811661..2811822 (+) 162 WP_000066011.1 DUF1270 domain-containing protein -
  E3S73_RS13885 (E3S73_13885) - 2811915..2812175 (+) 261 WP_000291488.1 DUF1108 family protein -
  E3S73_RS13890 (E3S73_13890) - 2812184..2812447 (+) 264 WP_001205732.1 hypothetical protein -
  E3S73_RS13895 (E3S73_13895) - 2812444..2814399 (+) 1956 WP_061741411.1 AAA family ATPase -
  E3S73_RS13900 (E3S73_13900) - 2814401..2815321 (+) 921 WP_000138475.1 recombinase RecT -
  E3S73_RS13905 (E3S73_13905) - 2815402..2816019 (+) 618 WP_072460574.1 MBL fold metallo-hydrolase -
  E3S73_RS13910 (E3S73_13910) ssbA 2816020..2816490 (+) 471 WP_000934770.1 single-stranded DNA-binding protein Machinery gene
  E3S73_RS13915 (E3S73_13915) - 2816520..2817404 (+) 885 WP_061741412.1 DnaD domain protein -
  E3S73_RS13920 (E3S73_13920) - 2817411..2817629 (+) 219 WP_000338528.1 hypothetical protein -
  E3S73_RS13925 (E3S73_13925) - 2817638..2818042 (+) 405 WP_000401964.1 RusA family crossover junction endodeoxyribonuclease -
  E3S73_RS13930 (E3S73_13930) - 2818055..2818423 (+) 369 WP_000101270.1 SA1788 family PVL leukocidin-associated protein -
  E3S73_RS13935 (E3S73_13935) - 2818427..2818669 (+) 243 WP_000131381.1 phi PVL orf 51-like protein -
  E3S73_RS13940 (E3S73_13940) - 2818684..2818932 (+) 249 WP_015974517.1 DUF1024 family protein -
  E3S73_RS13945 (E3S73_13945) - 2818925..2819461 (+) 537 WP_000185680.1 dUTPase -
  E3S73_RS13950 (E3S73_13950) - 2819498..2819740 (+) 243 WP_000028780.1 hypothetical protein -
  E3S73_RS13955 (E3S73_13955) - 2819737..2819925 (+) 189 WP_000195782.1 DUF1381 domain-containing protein -
  E3S73_RS13960 (E3S73_13960) - 2819900..2820100 (+) 201 WP_001125015.1 hypothetical protein -
  E3S73_RS13965 (E3S73_13965) rinB 2820103..2820252 (+) 150 WP_000237868.1 transcriptional activator RinB -
  E3S73_RS13970 (E3S73_13970) - 2820252..2820452 (+) 201 WP_001557462.1 DUF1514 family protein -
  E3S73_RS13975 (E3S73_13975) - 2820480..2820896 (+) 417 WP_000590122.1 hypothetical protein -
  E3S73_RS13980 (E3S73_13980) - 2821128..2821427 (+) 300 WP_000988330.1 HNH endonuclease -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17713.63 Da        Isoelectric Point: 5.2672

>NTDB_id=416692 E3S73_RS13910 WP_000934770.1 2816020..2816490(+) (ssbA) [Staphylococcus aureus strain UP_322]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=416692 E3S73_RS13910 WP_000934770.1 2816020..2816490(+) (ssbA) [Staphylococcus aureus strain UP_322]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment