Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | E3S99_RS13760 | Genome accession | NZ_CP047785 |
| Coordinates | 2770150..2770620 (+) | Length | 156 a.a. |
| NCBI ID | WP_000610648.1 | Uniprot ID | A0A090M1W2 |
| Organism | Staphylococcus aureus strain UP_1186 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2745435..2775952 | 2770150..2770620 | within | 0 |
Gene organization within MGE regions
Location: 2745435..2775952
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E3S99_RS13605 (E3S99_13605) | - | 2746736..2747362 (-) | 627 | WP_000522375.1 | nitroreductase family protein | - |
| E3S99_RS13610 (E3S99_13610) | - | 2747559..2748686 (+) | 1128 | WP_073402287.1 | SdrH family protein | - |
| E3S99_RS13615 (E3S99_13615) | mroQ | 2748711..2749454 (-) | 744 | WP_000197627.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| E3S99_RS13620 (E3S99_13620) | groES | 2749629..2749913 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| E3S99_RS13625 (E3S99_13625) | groL | 2749989..2751605 (+) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| E3S99_RS13630 (E3S99_13630) | - | 2752137..2753444 (-) | 1308 | WP_001045070.1 | TrkH family potassium uptake protein | - |
| E3S99_RS13635 (E3S99_13635) | - | 2753840..2755063 (-) | 1224 | WP_000206615.1 | ArgE/DapE family deacylase | - |
| E3S99_RS13640 (E3S99_13640) | - | 2755493..2756548 (+) | 1056 | WP_000791399.1 | leukocidin family pore-forming toxin | - |
| E3S99_RS13645 (E3S99_13645) | - | 2756570..2757589 (+) | 1020 | WP_000595616.1 | leukocidin/hemolysin toxin family protein | - |
| E3S99_RS13650 (E3S99_13650) | sph | 2757846..2758670 (-) | 825 | Protein_2649 | sphingomyelin phosphodiesterase | - |
| E3S99_RS13655 (E3S99_13655) | - | 2758727..2759764 (-) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| E3S99_RS13660 (E3S99_13660) | - | 2759823..2760287 (-) | 465 | WP_000825947.1 | hypothetical protein | - |
| E3S99_RS13665 (E3S99_13665) | - | 2760387..2760569 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| E3S99_RS13670 (E3S99_13670) | - | 2760773..2761114 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| E3S99_RS13675 (E3S99_13675) | - | 2761120..2762052 (-) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| E3S99_RS13680 (E3S99_13680) | - | 2762068..2762781 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| E3S99_RS13685 (E3S99_13685) | - | 2762744..2762917 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| E3S99_RS13690 (E3S99_13690) | - | 2762914..2763162 (+) | 249 | Protein_2657 | helix-turn-helix transcriptional regulator | - |
| E3S99_RS13695 (E3S99_13695) | - | 2763191..2763406 (+) | 216 | WP_001025404.1 | Thoeris anti-defense Tad2 family protein | - |
| E3S99_RS13700 (E3S99_13700) | - | 2763395..2763724 (-) | 330 | WP_000128907.1 | hypothetical protein | - |
| E3S99_RS13705 (E3S99_13705) | - | 2763775..2764527 (+) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| E3S99_RS13710 (E3S99_13710) | - | 2764543..2764740 (+) | 198 | WP_001148862.1 | hypothetical protein | - |
| E3S99_RS13715 (E3S99_13715) | - | 2764727..2765107 (-) | 381 | WP_000762519.1 | DUF2513 domain-containing protein | - |
| E3S99_RS13720 (E3S99_13720) | - | 2765162..2765485 (+) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| E3S99_RS13725 (E3S99_13725) | - | 2765482..2765643 (+) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| E3S99_RS13730 (E3S99_13730) | - | 2765738..2766040 (+) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| E3S99_RS13735 (E3S99_13735) | - | 2766045..2766305 (+) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| E3S99_RS13740 (E3S99_13740) | - | 2766314..2766577 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| E3S99_RS13745 (E3S99_13745) | - | 2766586..2768529 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| E3S99_RS13750 (E3S99_13750) | - | 2768531..2769451 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| E3S99_RS13755 (E3S99_13755) | - | 2769532..2770149 (+) | 618 | WP_073394849.1 | MBL fold metallo-hydrolase | - |
| E3S99_RS13760 (E3S99_13760) | ssbA | 2770150..2770620 (+) | 471 | WP_000610648.1 | single-stranded DNA-binding protein | Machinery gene |
| E3S99_RS13765 (E3S99_13765) | - | 2770650..2771543 (+) | 894 | WP_160199843.1 | DnaD domain protein | - |
| E3S99_RS13770 (E3S99_13770) | - | 2771550..2771768 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| E3S99_RS13775 (E3S99_13775) | - | 2771777..2772181 (+) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| E3S99_RS13780 (E3S99_13780) | - | 2772194..2772562 (+) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| E3S99_RS13785 (E3S99_13785) | - | 2772566..2772808 (+) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| E3S99_RS13790 (E3S99_13790) | - | 2772823..2773077 (+) | 255 | WP_001065097.1 | DUF1024 family protein | - |
| E3S99_RS13870 | - | 2773064..2773234 (+) | 171 | WP_000714403.1 | hypothetical protein | - |
| E3S99_RS13795 (E3S99_13795) | - | 2773227..2773763 (+) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| E3S99_RS13800 (E3S99_13800) | - | 2773800..2774045 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| E3S99_RS13805 (E3S99_13805) | - | 2774042..2774248 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| E3S99_RS13810 (E3S99_13810) | - | 2774245..2774631 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| E3S99_RS13815 (E3S99_13815) | rinB | 2774628..2774777 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| E3S99_RS13820 (E3S99_13820) | - | 2774777..2774977 (+) | 201 | WP_001622114.1 | DUF1514 family protein | - |
| E3S99_RS13825 (E3S99_13825) | - | 2775005..2775421 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| E3S99_RS13830 (E3S99_13830) | - | 2775653..2775952 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=416108 E3S99_RS13760 WP_000610648.1 2770150..2770620(+) (ssbA) [Staphylococcus aureus strain UP_1186]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=416108 E3S99_RS13760 WP_000610648.1 2770150..2770620(+) (ssbA) [Staphylococcus aureus strain UP_1186]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |