Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   E3T07_RS09455 Genome accession   NZ_CP047781
Coordinates   1827611..1828114 (-) Length   167 a.a.
NCBI ID   WP_000934799.1    Uniprot ID   A0A7U7IE99
Organism   Staphylococcus aureus strain UP_1452     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1773507..1832174 1827611..1828114 within 0


Gene organization within MGE regions


Location: 1773507..1832174
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  E3T07_RS09150 (E3T07_09150) - 1773507..1775063 (-) 1557 WP_000028598.1 type I restriction-modification system subunit M -
  E3T07_RS09155 (E3T07_09155) - 1775123..1775242 (+) 120 WP_031788484.1 hypothetical protein -
  E3T07_RS09160 (E3T07_09160) - 1775325..1776008 (-) 684 WP_160191400.1 superantigen-like protein SSL10 -
  E3T07_RS09165 (E3T07_09165) - 1776371..1777069 (-) 699 WP_000778481.1 superantigen-like protein SSL9 -
  E3T07_RS09170 (E3T07_09170) - 1777410..1778105 (-) 696 WP_000769829.1 superantigen-like protein SSL7 -
  E3T07_RS09175 (E3T07_09175) - 1778552..1779256 (-) 705 WP_160191401.1 superantigen-like protein SSL5 -
  E3T07_RS09180 (E3T07_09180) - 1779617..1780537 (-) 921 WP_000784525.1 superantigen-like protein SSL4 -
  E3T07_RS09185 (E3T07_09185) - 1780884..1781915 (-) 1032 WP_000702714.1 superantigen-like protein SSL3 -
  E3T07_RS09190 (E3T07_09190) - 1782203..1782904 (-) 702 WP_000782834.1 superantigen-like protein SSL2 -
  E3T07_RS09195 (E3T07_09195) - 1783187..1783867 (-) 681 WP_000668994.1 superantigen-like protein SSL1 -
  E3T07_RS09200 (E3T07_09200) - 1784339..1785184 (+) 846 WP_001024392.1 SDR family oxidoreductase -
  E3T07_RS09205 (E3T07_09205) - 1785203..1785562 (+) 360 WP_001021628.1 DUF1304 domain-containing protein -
  E3T07_RS09210 (E3T07_09210) - 1786084..1786236 (+) 153 WP_000248838.1 hypothetical protein -
  E3T07_RS09215 (E3T07_09215) - 1786494..1786820 (+) 327 WP_001799349.1 IS3 family transposase -
  E3T07_RS15090 - 1787345..1787458 (-) 114 Protein_1790 pathogenicity island protein -
  E3T07_RS09220 (E3T07_09220) - 1787965..1788670 (+) 706 Protein_1791 type II toxin-antitoxin system PemK/MazF family toxin -
  E3T07_RS09225 (E3T07_09225) - 1789062..1789598 (+) 537 WP_000551644.1 hypothetical protein -
  E3T07_RS09230 (E3T07_09230) guaA 1790128..1791669 (-) 1542 WP_000424963.1 glutamine-hydrolyzing GMP synthase -
  E3T07_RS09235 (E3T07_09235) guaB 1791694..1793160 (-) 1467 WP_000264071.1 IMP dehydrogenase -
  E3T07_RS09240 (E3T07_09240) pbuX 1793198..1794466 (-) 1269 WP_160191402.1 xanthine permease PbuX -
  E3T07_RS09245 (E3T07_09245) xpt 1794466..1795044 (-) 579 WP_000421416.1 xanthine phosphoribosyltransferase -
  E3T07_RS09250 (E3T07_09250) - 1795557..1795964 (+) 408 WP_001791353.1 general stress protein -
  E3T07_RS09255 (E3T07_09255) - 1796107..1796769 (+) 663 WP_160191403.1 hypothetical protein -
  E3T07_RS09260 (E3T07_09260) - 1796887..1797843 (+) 957 WP_160191404.1 hypothetical protein -
  E3T07_RS09265 (E3T07_09265) - 1798776..1798877 (-) 102 WP_001789518.1 hypothetical protein -
  E3T07_RS09270 (E3T07_09270) - 1798962..1800350 (+) 1389 WP_000991010.1 L-cystine transporter -
  E3T07_RS09275 (E3T07_09275) nfsA 1800430..1801185 (-) 756 WP_001279733.1 oxygen-insensitive NADPH nitroreductase -
  E3T07_RS09280 (E3T07_09280) ahpC 1801676..1802245 (+) 570 WP_000052781.1 alkyl hydroperoxide reductase subunit C -
  E3T07_RS09285 (E3T07_09285) ahpF 1802261..1803784 (+) 1524 WP_000930503.1 alkyl hydroperoxide reductase subunit F -
  E3T07_RS14995 - 1803899..1805518 (+) 1620 WP_000887770.1 hypothetical protein -
  E3T07_RS09295 (E3T07_09295) - 1805591..1806217 (+) 627 WP_000746688.1 NDxxF motif lipoprotein -
  E3T07_RS09300 (E3T07_09300) - 1806488..1806871 (+) 384 WP_001793753.1 hypothetical protein -
  E3T07_RS09305 (E3T07_09305) - 1806937..1807518 (-) 582 WP_000158375.1 histidine phosphatase family protein -
  E3T07_RS09310 (E3T07_09310) - 1807696..1807905 (+) 210 WP_000211680.1 hypothetical protein -
  E3T07_RS09315 (E3T07_09315) - 1807944..1808198 (-) 255 WP_000466746.1 GlsB/YeaQ/YmgE family stress response membrane protein -
  E3T07_RS09320 (E3T07_09320) - 1808492..1808755 (+) 264 WP_001055897.1 helix-turn-helix domain-containing protein -
  E3T07_RS09325 (E3T07_09325) - 1808893..1809465 (-) 573 WP_000769723.1 PepSY domain-containing protein -
  E3T07_RS09330 (E3T07_09330) - 1809646..1810014 (-) 369 WP_000849155.1 YxeA family protein -
  E3T07_RS09335 (E3T07_09335) - 1810251..1810965 (+) 715 Protein_1814 tyrosine-type recombinase/integrase -
  E3T07_RS09340 (E3T07_09340) - 1810971..1811978 (+) 1008 WP_001080636.1 Abi family protein -
  E3T07_RS15095 - 1812742..1812921 (-) 180 WP_000797954.1 hypothetical protein -
  E3T07_RS09345 (E3T07_09345) - 1812937..1813449 (-) 513 WP_160191405.1 hypothetical protein -
  E3T07_RS09350 (E3T07_09350) - 1813567..1813968 (-) 402 WP_000683457.1 hypothetical protein -
  E3T07_RS09355 (E3T07_09355) - 1814146..1815114 (-) 969 WP_000801980.1 Abi family protein -
  E3T07_RS09360 (E3T07_09360) - 1815391..1815960 (-) 570 WP_001293071.1 terminase small subunit -
  E3T07_RS09365 (E3T07_09365) - 1815957..1816169 (-) 213 WP_001656917.1 hypothetical protein -
  E3T07_RS09370 (E3T07_09370) - 1816301..1816828 (-) 528 WP_000771361.1 spore coat protein -
  E3T07_RS09375 (E3T07_09375) - 1816881..1817534 (-) 654 WP_000214170.1 hypothetical protein -
  E3T07_RS09380 (E3T07_09380) - 1817565..1817909 (-) 345 WP_001288442.1 hypothetical protein -
  E3T07_RS09385 (E3T07_09385) - 1818617..1819258 (-) 642 WP_001019762.1 hypothetical protein -
  E3T07_RS09390 (E3T07_09390) - 1819255..1819635 (-) 381 WP_000356942.1 hypothetical protein -
  E3T07_RS09395 (E3T07_09395) - 1819945..1821654 (-) 1710 WP_000447468.1 DUF927 domain-containing protein -
  E3T07_RS09400 (E3T07_09400) - 1821668..1822537 (-) 870 WP_001002709.1 primase alpha helix C-terminal domain-containing protein -
  E3T07_RS09405 (E3T07_09405) tscT 1822602..1822928 (-) 327 WP_001103967.1 type II toxin-antitoxin system toxin TscT -
  E3T07_RS09410 (E3T07_09410) - 1822929..1823312 (-) 384 WP_000403837.1 hypothetical protein -
  E3T07_RS09415 (E3T07_09415) - 1823314..1823517 (-) 204 WP_001231376.1 hypothetical protein -
  E3T07_RS09420 (E3T07_09420) - 1823484..1823657 (-) 174 WP_000784892.1 hypothetical protein -
  E3T07_RS09425 (E3T07_09425) - 1823669..1823941 (-) 273 WP_001138305.1 helix-turn-helix domain-containing protein -
  E3T07_RS09430 (E3T07_09430) - 1823942..1824106 (-) 165 WP_001611932.1 helix-turn-helix domain-containing protein -
  E3T07_RS09435 (E3T07_09435) - 1824255..1824878 (+) 624 WP_000230361.1 helix-turn-helix domain-containing protein -
  E3T07_RS09440 (E3T07_09440) - 1825039..1826253 (+) 1215 WP_000270135.1 tyrosine-type recombinase/integrase -
  E3T07_RS09445 (E3T07_09445) - 1826366..1827085 (+) 720 WP_000400841.1 type II toxin-antitoxin system PemK/MazF family toxin -
  E3T07_RS09450 (E3T07_09450) rpsR 1827317..1827559 (-) 243 WP_000897044.1 30S ribosomal protein S18 -
  E3T07_RS09455 (E3T07_09455) ssbA 1827611..1828114 (-) 504 WP_000934799.1 single-stranded DNA-binding protein Machinery gene
  E3T07_RS09460 (E3T07_09460) rpsF 1828135..1828431 (-) 297 WP_001261460.1 30S ribosomal protein S6 -
  E3T07_RS09465 (E3T07_09465) - 1828675..1828866 (+) 192 WP_001052483.1 hypothetical protein -
  E3T07_RS09470 (E3T07_09470) ychF 1828952..1830049 (-) 1098 WP_001218732.1 redox-regulated ATPase YchF -
  E3T07_RS09475 (E3T07_09475) - 1830061..1830264 (-) 204 WP_000157348.1 DUF951 domain-containing protein -
  E3T07_RS09480 (E3T07_09480) - 1830294..1831175 (-) 882 WP_000373076.1 mechanosensitive ion channel family protein -
  E3T07_RS09485 (E3T07_09485) - 1831329..1832174 (-) 846 WP_001573568.1 ParB/RepB/Spo0J family partition protein -

Sequence


Protein


Download         Length: 167 a.a.        Molecular weight: 18539.12 Da        Isoelectric Point: 4.7305

>NTDB_id=415935 E3T07_RS09455 WP_000934799.1 1827611..1828114(-) (ssbA) [Staphylococcus aureus strain UP_1452]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF

Nucleotide


Download         Length: 504 bp        

>NTDB_id=415935 E3T07_RS09455 WP_000934799.1 1827611..1828114(-) (ssbA) [Staphylococcus aureus strain UP_1452]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCACAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A7U7IE99

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

65.341

100

0.689

  ssb Latilactobacillus sakei subsp. sakei 23K

54.971

100

0.563

  ssbB Bacillus subtilis subsp. subtilis str. 168

58.491

63.473

0.371

  ssb Glaesserella parasuis strain SC1401

34.463

100

0.365


Multiple sequence alignment