Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   GTU60_RS08680 Genome accession   NZ_CP047670
Coordinates   1912929..1913459 (-) Length   176 a.a.
NCBI ID   WP_199265733.1    Uniprot ID   -
Organism   Alcaligenes faecalis strain SCSIO B001     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1906138..1957498 1912929..1913459 within 0


Gene organization within MGE regions


Location: 1906138..1957498
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GTU60_RS08635 - 1906138..1907367 (-) 1230 WP_199265724.1 tyrosine-type recombinase/integrase -
  GTU60_RS08640 - 1907367..1907621 (-) 255 WP_199265725.1 helix-turn-helix transcriptional regulator -
  GTU60_RS18525 - 1907903..1908193 (+) 291 WP_199265726.1 HNH endonuclease -
  GTU60_RS18395 - 1908221..1908607 (-) 387 WP_233249667.1 hypothetical protein -
  GTU60_RS08655 - 1909058..1910032 (-) 975 WP_199265728.1 DNA-methyltransferase -
  GTU60_RS08660 - 1910347..1910871 (+) 525 WP_199265729.1 hypothetical protein -
  GTU60_RS08665 - 1911018..1911914 (-) 897 WP_199265730.1 recombination-associated protein RdgC -
  GTU60_RS08670 - 1911904..1912134 (-) 231 WP_199265731.1 hypothetical protein -
  GTU60_RS08675 - 1912201..1912878 (+) 678 WP_199265732.1 hypothetical protein -
  GTU60_RS08680 ssb 1912929..1913459 (-) 531 WP_199265733.1 single-stranded DNA-binding protein Machinery gene
  GTU60_RS08685 - 1913462..1914199 (-) 738 WP_199265734.1 hypothetical protein -
  GTU60_RS08690 - 1914177..1914668 (-) 492 WP_199265735.1 hypothetical protein -
  GTU60_RS08695 - 1915107..1915529 (-) 423 WP_199265736.1 DUF551 domain-containing protein -
  GTU60_RS08700 - 1915621..1915980 (-) 360 WP_199265737.1 hypothetical protein -
  GTU60_RS08705 - 1916630..1916968 (-) 339 WP_199265738.1 hypothetical protein -
  GTU60_RS08710 - 1917035..1917340 (-) 306 WP_199265739.1 hypothetical protein -
  GTU60_RS08715 - 1917343..1917537 (-) 195 WP_199265740.1 hypothetical protein -
  GTU60_RS08720 - 1918420..1919391 (+) 972 WP_199265741.1 hypothetical protein -
  GTU60_RS08725 - 1919525..1919926 (+) 402 WP_199265742.1 hypothetical protein -
  GTU60_RS08730 - 1919957..1920385 (+) 429 WP_199265743.1 hypothetical protein -
  GTU60_RS08735 - 1921112..1921657 (-) 546 WP_199265744.1 hypothetical protein -
  GTU60_RS08740 - 1921862..1922242 (-) 381 WP_060185853.1 helix-turn-helix transcriptional regulator -
  GTU60_RS18530 - 1922291..1922551 (+) 261 WP_199265745.1 Cro/CI family transcriptional regulator -
  GTU60_RS08750 - 1923037..1923270 (-) 234 WP_199265898.1 hypothetical protein -
  GTU60_RS08755 - 1923285..1923596 (+) 312 WP_199265746.1 DNA-binding protein -
  GTU60_RS08760 - 1923599..1924009 (+) 411 WP_199265747.1 recombination protein NinB -
  GTU60_RS08765 - 1924048..1924368 (+) 321 WP_269848163.1 Ref family recombination enhancement nuclease -
  GTU60_RS08770 - 1924365..1925195 (+) 831 WP_199265749.1 helix-turn-helix domain-containing protein -
  GTU60_RS08775 - 1925197..1925850 (+) 654 WP_199265750.1 DUF6475 domain-containing protein -
  GTU60_RS08780 - 1925847..1926182 (+) 336 WP_199265751.1 DUF1064 domain-containing protein -
  GTU60_RS08785 - 1926332..1926691 (+) 360 WP_199265752.1 hypothetical protein -
  GTU60_RS08790 - 1927358..1927993 (+) 636 WP_199265753.1 putative metallopeptidase -
  GTU60_RS08795 - 1928024..1928497 (+) 474 WP_125277549.1 DUF2280 domain-containing protein -
  GTU60_RS08800 - 1928487..1929974 (+) 1488 WP_199265754.1 hypothetical protein -
  GTU60_RS08805 - 1929975..1930199 (+) 225 WP_199265755.1 hypothetical protein -
  GTU60_RS08810 - 1930196..1931563 (+) 1368 WP_199265756.1 anti-CBASS protein Acb1 family protein -
  GTU60_RS08815 - 1931607..1932455 (+) 849 WP_199265757.1 phage minor head protein -
  GTU60_RS08820 - 1932490..1933824 (+) 1335 WP_199265758.1 hypothetical protein -
  GTU60_RS08825 - 1933828..1934271 (+) 444 WP_199265759.1 phage cement protein -
  GTU60_RS08830 - 1934284..1935375 (+) 1092 WP_199265760.1 major capsid protein -
  GTU60_RS08835 - 1935386..1935754 (+) 369 WP_199265761.1 hypothetical protein -
  GTU60_RS08840 - 1935910..1936416 (+) 507 WP_199265762.1 Rha family transcriptional regulator -
  GTU60_RS08845 - 1936454..1936855 (+) 402 WP_199265763.1 DUF7370 family protein -
  GTU60_RS08850 - 1936855..1937172 (+) 318 WP_199265764.1 hypothetical protein -
  GTU60_RS08855 - 1937172..1937591 (+) 420 WP_199265765.1 hypothetical protein -
  GTU60_RS08860 - 1937569..1937943 (+) 375 WP_199265766.1 hypothetical protein -
  GTU60_RS08865 - 1937953..1938696 (+) 744 WP_199265767.1 phage tail protein -
  GTU60_RS08870 - 1938774..1939277 (+) 504 WP_199265768.1 DUF6246 family protein -
  GTU60_RS08875 - 1939341..1939919 (+) 579 WP_199265769.1 hypothetical protein -
  GTU60_RS08880 - 1939978..1942584 (+) 2607 WP_199265770.1 tape measure protein -
  GTU60_RS08885 - 1942692..1943078 (+) 387 WP_199265771.1 hypothetical protein -
  GTU60_RS08890 - 1943065..1943571 (+) 507 WP_199265772.1 hypothetical protein -
  GTU60_RS08895 - 1943568..1943906 (+) 339 WP_199265773.1 hypothetical protein -
  GTU60_RS08900 - 1943903..1946770 (+) 2868 WP_199265774.1 host specificity factor TipJ family phage tail protein -
  GTU60_RS08905 - 1946832..1949093 (+) 2262 WP_199265775.1 FAD-dependent oxidoreductase -
  GTU60_RS08910 - 1949104..1949967 (+) 864 WP_199265776.1 hypothetical protein -
  GTU60_RS08915 - 1950146..1951882 (+) 1737 WP_199265777.1 heparinase II/III domain-containing protein -
  GTU60_RS08920 - 1951986..1952240 (+) 255 WP_199265778.1 twin-arginine translocase TatA/TatE family subunit -
  GTU60_RS08925 - 1952224..1952682 (+) 459 WP_199265779.1 lysozyme -
  GTU60_RS08930 - 1952661..1953143 (+) 483 WP_094196311.1 DUF2514 family protein -
  GTU60_RS08935 - 1953169..1953789 (-) 621 WP_199265780.1 hypothetical protein -
  GTU60_RS08940 - 1953980..1954990 (-) 1011 WP_199265781.1 restriction endonuclease -
  GTU60_RS08945 - 1956675..1957094 (-) 420 WP_199265782.1 BON domain-containing protein -

Sequence

Protein


Download         Length: 176 a.a.        Molecular weight: 19702.78 Da        Isoelectric Point: 7.1374

>NTDB_id=415153 GTU60_RS08680 WP_199265733.1 1912929..1913459(-) (ssb) [Alcaligenes faecalis strain SCSIO B001]
MASVNKVILVGNLGRDPEVRYSAEGSAICNISIATTSQWKDRTSGERREETEWHRVVFYNRLAEIASEYLRKGRPVYVEG
RLRTRKWAGQDGQERFTTEIIAEQMQMLGGRDDGGEGHGNAPQPEQRQSKGQQRNGYADATGRGQQQRQAPTSGNLADMD
DDIPFAPLLSRNAYCV

Nucleotide


Download         Length: 531 bp        

>NTDB_id=415153 GTU60_RS08680 WP_199265733.1 1912929..1913459(-) (ssb) [Alcaligenes faecalis strain SCSIO B001]
ATGGCCTCAGTCAACAAAGTCATTCTGGTGGGCAATCTTGGTCGCGACCCAGAAGTACGCTACAGCGCAGAAGGCTCGGC
CATCTGCAATATTTCCATTGCCACGACTTCGCAGTGGAAAGACCGTACCTCCGGCGAGCGCCGTGAGGAAACCGAATGGC
ACCGTGTGGTGTTCTACAACCGTCTGGCTGAAATCGCGAGTGAGTACCTGCGCAAAGGCCGTCCCGTTTACGTAGAAGGT
CGCCTGCGCACCCGTAAATGGGCAGGTCAGGATGGTCAGGAGCGCTTCACCACCGAGATCATCGCCGAGCAAATGCAGAT
GCTGGGCGGTCGTGACGACGGTGGAGAAGGCCACGGCAATGCACCCCAGCCAGAGCAGCGGCAATCGAAGGGCCAGCAGC
GTAACGGCTACGCTGATGCAACTGGGCGCGGGCAGCAACAGAGACAAGCGCCGACGTCCGGCAATCTGGCGGATATGGAC
GATGACATTCCATTCGCTCCGCTGCTCTCACGCAATGCTTACTGTGTTTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

48.901

100

0.506
  ssb Neisseria meningitidis MC58

48

99.432

0.477
  ssb Neisseria gonorrhoeae MS11

48

99.432

0.477
  ssb Glaesserella parasuis strain SC1401

46.111

100

0.472

Multiple sequence alignment