Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   GT733_RS16350 Genome accession   NZ_CP047589
Coordinates   3559582..3560106 (+) Length   174 a.a.
NCBI ID   WP_004249162.1    Uniprot ID   A0A1Z1SRL1
Organism   Proteus mirabilis strain SNYG35     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3509327..3561781 3559582..3560106 within 0


Gene organization within MGE regions


Location: 3509327..3561781
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GT733_RS16100 (GT733_16170) - 3509327..3510973 (-) 1647 WP_206092375.1 hypothetical protein -
  GT733_RS16105 (GT733_16175) - 3510960..3511520 (-) 561 WP_143475709.1 hypothetical protein -
  GT733_RS16110 (GT733_16180) - 3511531..3512253 (-) 723 WP_206092373.1 hypothetical protein -
  GT733_RS16115 (GT733_16185) - 3512250..3512672 (-) 423 WP_049212315.1 tail fiber assembly protein -
  GT733_RS16120 (GT733_16190) - 3512674..3514602 (-) 1929 WP_206092371.1 phage tail protein -
  GT733_RS16125 (GT733_16195) - 3514606..3515163 (-) 558 WP_049212312.1 phage tail protein -
  GT733_RS16130 (GT733_16200) - 3515156..3516340 (-) 1185 WP_206092369.1 baseplate J/gp47 family protein -
  GT733_RS16135 (GT733_16205) - 3516330..3516665 (-) 336 WP_060557617.1 DUF2590 family protein -
  GT733_RS16140 (GT733_16210) - 3516676..3519192 (-) 2517 WP_206092367.1 phage tail tape measure protein -
  GT733_RS19555 - 3519192..3519335 (-) 144 WP_165544879.1 DUF6890 family protein -
  GT733_RS16145 (GT733_16215) - 3519380..3519649 (-) 270 WP_049220759.1 putative phage tail assembly chaperone -
  GT733_RS16150 (GT733_16220) - 3519758..3520132 (-) 375 WP_102780817.1 hypothetical protein -
  GT733_RS16155 (GT733_16225) - 3520129..3520554 (-) 426 WP_071233399.1 structural protein -
  GT733_RS16160 (GT733_16230) - 3520551..3520844 (-) 294 WP_036907276.1 phage holin family protein -
  GT733_RS16165 (GT733_16235) - 3520859..3521311 (-) 453 WP_036907273.1 DUF2597 family protein -
  GT733_RS16170 (GT733_16240) - 3521311..3522429 (-) 1119 WP_196543745.1 DUF2586 domain-containing protein -
  GT733_RS16175 (GT733_16245) - 3522444..3523142 (-) 699 WP_206092365.1 hypothetical protein -
  GT733_RS16180 (GT733_16250) - 3523139..3523615 (-) 477 WP_071233402.1 phage tail protein -
  GT733_RS16185 (GT733_16255) - 3523612..3524064 (-) 453 WP_036907264.1 head completion/stabilization protein -
  GT733_RS16190 (GT733_16260) gpM 3524399..3525103 (-) 705 WP_049218878.1 phage terminase small subunit -
  GT733_RS16195 (GT733_16265) - 3525109..3526140 (-) 1032 WP_049218876.1 phage major capsid protein, P2 family -
  GT733_RS16200 (GT733_16270) - 3526151..3526987 (-) 837 WP_049212290.1 GPO family capsid scaffolding protein -
  GT733_RS16205 (GT733_16275) - 3527149..3528936 (+) 1788 WP_206092363.1 terminase large subunit domain-containing protein -
  GT733_RS16210 (GT733_16280) - 3528936..3529970 (+) 1035 WP_174815125.1 phage portal protein -
  GT733_RS16215 (GT733_16285) - 3529967..3530275 (+) 309 WP_036907246.1 ogr/Delta-like zinc finger family protein -
  GT733_RS16220 (GT733_16290) - 3530277..3530459 (-) 183 WP_036907243.1 hypothetical protein -
  GT733_RS16225 (GT733_16295) - 3530778..3532970 (-) 2193 WP_206092361.1 replication endonuclease -
  GT733_RS16230 (GT733_16300) - 3532972..3533223 (-) 252 WP_036907235.1 DUF2732 family protein -
  GT733_RS16235 (GT733_16305) - 3533300..3533647 (-) 348 WP_088206999.1 DUF5347 domain-containing protein -
  GT733_RS16240 (GT733_16310) - 3533812..3534321 (-) 510 WP_088206998.1 phage regulatory CII family protein -
  GT733_RS16245 (GT733_16315) - 3534351..3534575 (-) 225 WP_036907225.1 helix-turn-helix transcriptional regulator -
  GT733_RS16250 (GT733_16320) - 3534725..3535315 (+) 591 WP_052124619.1 phage repressor protein CI -
  GT733_RS16255 (GT733_16325) - 3535330..3535752 (+) 423 WP_036907222.1 hypothetical protein -
  GT733_RS16260 (GT733_16330) - 3535757..3536788 (+) 1032 WP_088206997.1 tyrosine-type recombinase/integrase -
  GT733_RS16265 (GT733_16335) - 3536882..3538258 (+) 1377 WP_270049394.1 fimbria/pilus outer membrane usher protein -
  GT733_RS16270 (GT733_16340) - 3538258..3538776 (+) 519 WP_004245882.1 fimbrial protein -
  GT733_RS16275 (GT733_16345) - 3538776..3539849 (+) 1074 WP_202054673.1 fimbrial protein -
  GT733_RS16280 (GT733_16350) - 3539876..3540193 (+) 318 WP_004245886.1 helix-turn-helix domain-containing protein -
  GT733_RS16285 (GT733_16355) potD 3540326..3541369 (-) 1044 WP_004245887.1 spermidine/putrescine ABC transporter substrate-binding protein PotD -
  GT733_RS16290 (GT733_16360) potC 3541486..3542265 (-) 780 WP_004245888.1 spermidine/putrescine ABC transporter permease PotC -
  GT733_RS16295 (GT733_16365) potB 3542262..3543122 (-) 861 WP_004250112.1 spermidine/putrescine ABC transporter permease PotB -
  GT733_RS16300 (GT733_16370) potA 3543106..3544221 (-) 1116 WP_004245891.1 spermidine/putrescine ABC transporter ATP-binding protein PotA -
  GT733_RS16305 (GT733_16375) - 3544665..3545939 (-) 1275 WP_223878647.1 S8 family peptidase -
  GT733_RS16310 (GT733_16380) dusA 3546896..3547930 (+) 1035 WP_012368489.1 tRNA dihydrouridine(20/20a) synthase DusA -
  GT733_RS16315 (GT733_16385) - 3548037..3549020 (-) 984 WP_004245895.1 NADPH:quinone reductase -
  GT733_RS16320 (GT733_16390) dnaB 3549188..3550597 (+) 1410 WP_004245896.1 replicative DNA helicase -
  GT733_RS16325 (GT733_16395) alr 3550638..3551729 (+) 1092 WP_036907212.1 alanine racemase -
  GT733_RS16330 (GT733_16400) - 3551785..3552978 (+) 1194 WP_004249167.1 aromatic amino acid transaminase -
  GT733_RS16335 (GT733_16405) - 3553100..3554449 (-) 1350 WP_004245900.1 serine dehydratase subunit alpha family protein -
  GT733_RS16340 (GT733_16410) - 3554511..3555842 (-) 1332 WP_004249166.1 amino acid permease -
  GT733_RS16345 (GT733_16415) uvrA 3556495..3559329 (-) 2835 WP_036919181.1 excinuclease ABC subunit UvrA -
  GT733_RS16350 (GT733_16420) ssb 3559582..3560106 (+) 525 WP_004249162.1 single-stranded DNA-binding protein SSB1 Machinery gene
  GT733_RS16355 (GT733_16425) zur 3560447..3560977 (+) 531 WP_049257468.1 zinc uptake transcriptional repressor Zur -
  GT733_RS16360 (GT733_16430) lexA 3561170..3561781 (-) 612 WP_004245906.1 transcriptional repressor LexA -

Sequence


Protein


Download         Length: 174 a.a.        Molecular weight: 18830.90 Da        Isoelectric Point: 4.9468

>NTDB_id=414359 GT733_RS16350 WP_004249162.1 3559582..3560106(+) (ssb) [Proteus mirabilis strain SNYG35]
MASRGVNKVILIGNLGQDPEIRYMPSGGAVANLTLATSESWRDKQTGEMKEKTEWHRVVIFGKLAEIAGEYLRKGSQVYI
EGQLQTRKWQDQSGQDRYSTEVVVNIGGTMQMLGGRGGQDNAPSQGQGGWGQPQQPQASQQFSGGAPSRPAQQPAAAPAP
SNEPPMDFDDDIPF

Nucleotide


Download         Length: 525 bp        

>NTDB_id=414359 GT733_RS16350 WP_004249162.1 3559582..3560106(+) (ssb) [Proteus mirabilis strain SNYG35]
ATGGCGAGCAGAGGCGTTAACAAAGTTATTCTTATCGGTAATTTAGGGCAGGATCCAGAAATCCGTTATATGCCAAGTGG
TGGTGCAGTGGCAAATCTGACACTAGCAACTTCAGAAAGCTGGCGCGACAAACAAACCGGTGAAATGAAAGAGAAAACCG
AATGGCACCGTGTGGTCATTTTCGGCAAACTAGCAGAAATTGCTGGCGAGTATCTGCGTAAAGGTTCACAAGTTTATATT
GAAGGTCAATTACAAACACGTAAATGGCAAGATCAAAGTGGTCAAGATCGCTACAGCACTGAAGTTGTGGTGAATATCGG
TGGCACAATGCAGATGTTAGGTGGCCGTGGTGGTCAAGATAATGCACCTTCACAAGGCCAAGGCGGTTGGGGTCAACCTC
AGCAACCACAAGCATCACAACAGTTTAGTGGTGGCGCACCATCTCGCCCAGCACAACAACCAGCGGCGGCACCAGCGCCA
AGTAATGAACCACCAATGGACTTTGATGACGATATTCCGTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A1Z1SRL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

71.892

100

0.764

  ssb Glaesserella parasuis strain SC1401

57.065

100

0.603

  ssb Neisseria meningitidis MC58

48.023

100

0.489

  ssb Neisseria gonorrhoeae MS11

48.023

100

0.489


Multiple sequence alignment