Detailed information NTG0411689

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: GRT08_RS11995
• Genome accession: NZ_CP047234
• Coordinates: 2473501..2473938 (-)
• Length: 145 a.a.
• NCBI ID: WP_025852922.1
• Uniprot ID: -
• Organism: Bacillus amyloliquefaciens strain FJ4
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2468501..2478938

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GRT08_RS11945 (GRT08_11775)	sinI	2468886..2469059 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
GRT08_RS11950 (GRT08_11780)	sinR	2469093..2469428 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
GRT08_RS11955 (GRT08_11785)	tasA	2469476..2470261 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
GRT08_RS11960 (GRT08_11790)	sipW	2470325..2470909 (-)	585	WP_060562614.1	signal peptidase I SipW	-
GRT08_RS11965 (GRT08_11795)	tapA	2470881..2471552 (-)	672	WP_071391613.1	amyloid fiber anchoring/assembly protein TapA	-
GRT08_RS11970 (GRT08_11800)	-	2471811..2472140 (+)	330	WP_071391612.1	DUF3889 domain-containing protein	-
GRT08_RS11975 (GRT08_11805)	-	2472180..2472359 (-)	180	WP_003153093.1	YqzE family protein	-
GRT08_RS11980 (GRT08_11810)	comGG	2472416..2472793 (-)	378	WP_071391611.1	competence type IV pilus minor pilin ComGG	Machinery gene
GRT08_RS11985 (GRT08_11815)	comGF	2472794..2473189 (-)	396	WP_071391610.1	competence type IV pilus minor pilin ComGF	-
GRT08_RS11990 (GRT08_11820)	comGE	2473203..2473517 (-)	315	WP_015388003.1	competence type IV pilus minor pilin ComGE	Machinery gene
GRT08_RS11995 (GRT08_11825)	comGD	2473501..2473938 (-)	438	WP_025852922.1	competence type IV pilus minor pilin ComGD	Machinery gene
GRT08_RS12000 (GRT08_11830)	comGC	2473928..2474236 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
GRT08_RS12005 (GRT08_11835)	comGB	2474241..2475278 (-)	1038	WP_063174751.1	competence type IV pilus assembly protein ComGB	Machinery gene
GRT08_RS12010 (GRT08_11840)	comGA	2475265..2476335 (-)	1071	WP_003153083.1	competence type IV pilus ATPase ComGA	Machinery gene
GRT08_RS12015 (GRT08_11845)	-	2476526..2477476 (-)	951	WP_071391609.1	magnesium transporter CorA family protein	-
GRT08_RS12020 (GRT08_11850)	-	2477622..2478923 (+)	1302	WP_070082114.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16268.78 Da
• Isoelectric Point: 10.1850

>NTDB_id=411689 GRT08_RS11995 WP_025852922.1 2473501..2473938(-) (comGD) [Bacillus amyloliquefaciens strain FJ4]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSAGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=411689 GRT08_RS11995 WP_025852922.1 2473501..2473938(-) (comGD) [Bacillus amyloliquefaciens strain FJ4]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGCCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTAACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	54.795	100	0.552