Detailed information
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | GPZ88_RS03320 | Genome accession | NZ_CP046919 |
| Coordinates | 643728..643880 (+) | Length | 50 a.a. |
| NCBI ID | WP_158914538.1 | Uniprot ID | A0A6G8HZ72 |
| Organism | Streptococcus ruminicola strain CNU_G2 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 638728..648880
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GPZ88_RS03295 (GPZ88_03270) | comD/comD3 | 639568..640650 (-) | 1083 | WP_240915107.1 | sensor histidine kinase | Regulator |
| GPZ88_RS10350 | comD/comD2 | 640943..641773 (-) | 831 | WP_240915108.1 | sensor histidine kinase | Regulator |
| GPZ88_RS03305 (GPZ88_03280) | - | 642677..642970 (-) | 294 | WP_074626913.1 | bacteriocin immunity protein | - |
| GPZ88_RS03310 (GPZ88_03285) | - | 642998..643303 (-) | 306 | WP_158914537.1 | bacteriocin immunity protein | - |
| GPZ88_RS03315 (GPZ88_03290) | - | 643316..643465 (-) | 150 | WP_039696228.1 | hypothetical protein | - |
| GPZ88_RS03320 (GPZ88_03295) | comC/comC1 | 643728..643880 (+) | 153 | WP_158914538.1 | hypothetical protein | Regulator |
| GPZ88_RS03325 (GPZ88_03300) | comD/comD1 | 643903..645228 (-) | 1326 | WP_166043386.1 | sensor histidine kinase | Regulator |
| GPZ88_RS03330 (GPZ88_03305) | comE/comE1 | 645233..645964 (-) | 732 | WP_166043387.1 | response regulator transcription factor | Regulator |
| GPZ88_RS03335 (GPZ88_03310) | - | 646732..647421 (-) | 690 | WP_074626894.1 | CPBP family intramembrane glutamic endopeptidase | - |
| GPZ88_RS03340 (GPZ88_03315) | - | 647486..647638 (-) | 153 | WP_159428313.1 | hypothetical protein | - |
| GPZ88_RS03345 (GPZ88_03320) | - | 647652..647792 (-) | 141 | WP_159428314.1 | bacteriocin class II family protein | - |
| GPZ88_RS03350 (GPZ88_03325) | - | 647815..648423 (-) | 609 | WP_074626895.1 | CPBP family intramembrane glutamic endopeptidase | - |
| GPZ88_RS03355 (GPZ88_03330) | - | 648398..648562 (-) | 165 | WP_159428316.1 | lactococcin G-beta/enterocin 1071B family bacteriocin | - |
| GPZ88_RS03360 (GPZ88_03335) | - | 648565..648720 (-) | 156 | WP_107374736.1 | bacteriocin class II family protein | - |
Sequence
Protein
Download Length: 50 a.a. Molecular weight: 5611.44 Da Isoelectric Point: 4.9103
>NTDB_id=409406 GPZ88_RS03320 WP_158914538.1 643728..643880(+) (comC/comC1) [Streptococcus ruminicola strain CNU_G2]
MTEWKMSELESVKDLTDSDLEKTVGGDNIPLLTGVGDLFKIFKGKNKNHM
MTEWKMSELESVKDLTDSDLEKTVGGDNIPLLTGVGDLFKIFKGKNKNHM
Nucleotide
Download Length: 153 bp
>NTDB_id=409406 GPZ88_RS03320 WP_158914538.1 643728..643880(+) (comC/comC1) [Streptococcus ruminicola strain CNU_G2]
ATGACAGAATGGAAAATGTCAGAGTTAGAATCAGTCAAAGACTTGACTGATTCTGATTTGGAGAAGACAGTTGGAGGGGA
TAATATCCCTCTACTTACTGGTGTTGGTGATTTATTTAAAATTTTTAAAGGAAAAAATAAAAATCACATGTAA
ATGACAGAATGGAAAATGTCAGAGTTAGAATCAGTCAAAGACTTGACTGATTCTGATTTGGAGAAGACAGTTGGAGGGGA
TAATATCCCTCTACTTACTGGTGTTGGTGATTTATTTAAAATTTTTAAAGGAAAAAATAAAAATCACATGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus equinus JB1 |
75.51 |
98 |
0.74 |