Detailed information    

insolico Bioinformatically predicted

Overview


Name   comC/comC1   Type   Regulator
Locus tag   GPZ88_RS03320 Genome accession   NZ_CP046919
Coordinates   643728..643880 (+) Length   50 a.a.
NCBI ID   WP_158914538.1    Uniprot ID   A0A6G8HZ72
Organism   Streptococcus ruminicola strain CNU_G2     
Function   binding to ComD; induce autophosphorylation of ComD (predicted from homology)   
Competence regulation

Genomic Context


Location: 638728..648880
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GPZ88_RS03295 (GPZ88_03270) comD/comD3 639568..640650 (-) 1083 WP_240915107.1 sensor histidine kinase Regulator
  GPZ88_RS10350 comD/comD2 640943..641773 (-) 831 WP_240915108.1 sensor histidine kinase Regulator
  GPZ88_RS03305 (GPZ88_03280) - 642677..642970 (-) 294 WP_074626913.1 bacteriocin immunity protein -
  GPZ88_RS03310 (GPZ88_03285) - 642998..643303 (-) 306 WP_158914537.1 bacteriocin immunity protein -
  GPZ88_RS03315 (GPZ88_03290) - 643316..643465 (-) 150 WP_039696228.1 hypothetical protein -
  GPZ88_RS03320 (GPZ88_03295) comC/comC1 643728..643880 (+) 153 WP_158914538.1 hypothetical protein Regulator
  GPZ88_RS03325 (GPZ88_03300) comD/comD1 643903..645228 (-) 1326 WP_166043386.1 sensor histidine kinase Regulator
  GPZ88_RS03330 (GPZ88_03305) comE/comE1 645233..645964 (-) 732 WP_166043387.1 response regulator transcription factor Regulator
  GPZ88_RS03335 (GPZ88_03310) - 646732..647421 (-) 690 WP_074626894.1 CPBP family intramembrane glutamic endopeptidase -
  GPZ88_RS03340 (GPZ88_03315) - 647486..647638 (-) 153 WP_159428313.1 hypothetical protein -
  GPZ88_RS03345 (GPZ88_03320) - 647652..647792 (-) 141 WP_159428314.1 bacteriocin class II family protein -
  GPZ88_RS03350 (GPZ88_03325) - 647815..648423 (-) 609 WP_074626895.1 CPBP family intramembrane glutamic endopeptidase -
  GPZ88_RS03355 (GPZ88_03330) - 648398..648562 (-) 165 WP_159428316.1 lactococcin G-beta/enterocin 1071B family bacteriocin -
  GPZ88_RS03360 (GPZ88_03335) - 648565..648720 (-) 156 WP_107374736.1 bacteriocin class II family protein -

Sequence


Protein


Download         Length: 50 a.a.        Molecular weight: 5611.44 Da        Isoelectric Point: 4.9103

>NTDB_id=409406 GPZ88_RS03320 WP_158914538.1 643728..643880(+) (comC/comC1) [Streptococcus ruminicola strain CNU_G2]
MTEWKMSELESVKDLTDSDLEKTVGGDNIPLLTGVGDLFKIFKGKNKNHM

Nucleotide


Download         Length: 153 bp        

>NTDB_id=409406 GPZ88_RS03320 WP_158914538.1 643728..643880(+) (comC/comC1) [Streptococcus ruminicola strain CNU_G2]
ATGACAGAATGGAAAATGTCAGAGTTAGAATCAGTCAAAGACTTGACTGATTCTGATTTGGAGAAGACAGTTGGAGGGGA
TAATATCCCTCTACTTACTGGTGTTGGTGATTTATTTAAAATTTTTAAAGGAAAAAATAAAAATCACATGTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6G8HZ72

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/comC1 Streptococcus equinus JB1

75.51

98

0.74


Multiple sequence alignment