Detailed information    

insolico Bioinformatically predicted

Overview

Name   comC/comC1   Type   Regulator
Locus tag   GP482_RS07050 Genome accession   NZ_CP046875
Coordinates   1446045..1446197 (+) Length   50 a.a.
NCBI ID   WP_158914538.1    Uniprot ID   A0A6G8HZ72
Organism   Streptococcus ruminicola strain CNU_77-61     
Function   binding to ComD; induce autophosphorylation of ComD (predicted from homology)   
Competence regulation

Genomic Context

Location: 1441045..1451197
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GP482_RS07025 (GP482_07025) comD/comD3 1442087..1443460 (-) 1374 WP_254058924.1 GHKL domain-containing protein Regulator
  GP482_RS09650 comD/comD3 1443453..1444244 (-) 792 WP_240187156.1 GHKL domain-containing protein Regulator
  GP482_RS07035 (GP482_07035) - 1444994..1445287 (-) 294 WP_158914536.1 bacteriocin immunity protein -
  GP482_RS07040 (GP482_07040) - 1445315..1445620 (-) 306 WP_158914537.1 bacteriocin immunity protein -
  GP482_RS07045 (GP482_07045) - 1445633..1445782 (-) 150 WP_039696228.1 hypothetical protein -
  GP482_RS07050 (GP482_07050) comC/comC1 1446045..1446197 (+) 153 WP_158914538.1 hypothetical protein Regulator
  GP482_RS07055 (GP482_07055) comD/comD1 1446220..1447539 (-) 1320 WP_158914539.1 GHKL domain-containing protein Regulator
  GP482_RS07060 (GP482_07060) comE/comE1 1447544..1448275 (-) 732 WP_158914540.1 response regulator transcription factor Regulator
  GP482_RS07065 (GP482_07065) - 1448780..1449391 (-) 612 WP_254058925.1 thioredoxin family protein -
  GP482_RS07070 (GP482_07070) - 1449581..1449892 (-) 312 WP_061408660.1 hypothetical protein -
  GP482_RS07075 (GP482_07075) - 1449958..1450191 (-) 234 WP_158914541.1 ComC/BlpC family peptide pheromone/bacteriocin -

Sequence

Protein


Download         Length: 50 a.a.        Molecular weight: 5611.44 Da        Isoelectric Point: 4.9103

>NTDB_id=409132 GP482_RS07050 WP_158914538.1 1446045..1446197(+) (comC/comC1) [Streptococcus ruminicola strain CNU_77-61]
MTEWKMSELESVKDLTDSDLEKTVGGDNIPLLTGVGDLFKIFKGKNKNHM

Nucleotide


Download         Length: 153 bp        

>NTDB_id=409132 GP482_RS07050 WP_158914538.1 1446045..1446197(+) (comC/comC1) [Streptococcus ruminicola strain CNU_77-61]
ATGACAGAATGGAAAATGTCAGAGTTAGAATCAGTCAAAGACTTGACTGATTCTGATTTGGAGAAGACAGTTGGAGGGGA
TAATATTCCTCTACTTACTGGTGTTGGTGATTTATTTAAAATTTTTAAAGGAAAAAATAAAAATCACATGTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6G8HZ72

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/comC1 Streptococcus equinus JB1

75.51

98

0.74

Multiple sequence alignment