Detailed information NTG0040603

Bioinformatically predicted

Overview

• Name: ssb
• Type: Machinery gene
• Locus tag: PT7_RS13880
• Genome accession: NC_015458
• Coordinates: 3010605..3011093 (-)
• Length: 162 a.a.
• NCBI ID: WP_013743913.1
• Uniprot ID: F4GWZ8
• Organism: Pusillimonas sp. T7-7
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	2991240..3011093	3010605..3011093	within	0

Gene organization within MGE regions

Location: 2991240..3011093

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PT7_RS13780	phnC	2991240..2992040 (+)	801	WP_041682765.1	phosphonate ABC transporter ATP-binding protein	-
PT7_RS13785 (PT7_2831)	-	2992060..2993061 (+)	1002	WP_026485313.1	phosphonate dehydrogenase	-
PT7_RS13790 (PT7_2832)	-	2993066..2993935 (+)	870	WP_013743899.1	LysR family transcriptional regulator	-
PT7_RS13795 (PT7_2833)	-	2994168..2994407 (-)	240	Protein_2749	transposase	-
PT7_RS13800	-	2994603..2995082 (-)	480	WP_228129189.1	hypothetical protein	-
PT7_RS13805 (PT7_2834)	-	2995072..2996649 (-)	1578	WP_228129190.1	integrase	-
PT7_RS18895	-	2996791..2997530 (+)	740	Protein_2752	IS3 family transposase	-
PT7_RS13820 (PT7_2836)	ltrA	2998197..2999729 (+)	1533	WP_013743903.1	group II intron reverse transcriptase/maturase	-
PT7_RS13825 (PT7_2837)	-	2999813..3000037 (+)	225	Protein_2754	DDE-type integrase/transposase/recombinase	-
PT7_RS13830 (PT7_2838)	-	3000077..3001453 (+)	1377	WP_083812509.1	IS30 family transposase	-
PT7_RS13835 (PT7_2839)	-	3001634..3002077 (+)	444	WP_013743906.1	transposase	-
PT7_RS13840 (PT7_2840)	tnpB	3002074..3002406 (+)	333	WP_013743907.1	IS66 family insertion sequence element accessory protein TnpB	-
PT7_RS13845 (PT7_2841)	-	3002485..3004089 (+)	1605	WP_013743908.1	IS66 family transposase	-
PT7_RS13850 (PT7_2842)	-	3004145..3004366 (+)	222	Protein_2759	integrase core domain-containing protein	-
PT7_RS13860	-	3005144..3005572 (-)	429	WP_041682769.1	hypothetical protein	-
PT7_RS13865 (PT7_2843)	-	3005609..3007618 (-)	2010	WP_013743910.1	integrase	-
PT7_RS13870 (PT7_2844)	-	3007611..3009152 (-)	1542	WP_013743911.1	site-specific integrase	-
PT7_RS13875 (PT7_2845)	-	3009145..3010425 (-)	1281	WP_013743912.1	site-specific integrase	-
PT7_RS13880 (PT7_2846)	ssb	3010605..3011093 (-)	489	WP_013743913.1	single-stranded DNA-binding protein	Machinery gene

Sequence

Protein

• Length: 162 a.a.
• Molecular weight: 17777.76 Da
• Isoelectric Point: 5.9575

>NTDB_id=40603 PT7_RS13880 WP_013743913.1 3010605..3011093(-) (ssb) [Pusillimonas sp. T7-7]
MASVNKVILVGNLGRDPEVRYSPDGAAICNVSIATTSTWKDKASGEKREETEWHRVVFYNRLAEIAGEYLKKGRSVYVEG
RLKTRKWQDKDTGADRYSTDIVADQMQMLGGREGGDASMGGGTEYNQAPAQQRSQRPAQPRPAAPQASPAANLADMDDDI
PF

Nucleotide

• Length: 489 bp

>NTDB_id=40603 PT7_RS13880 WP_013743913.1 3010605..3011093(-) (ssb) [Pusillimonas sp. T7-7]
ATGGCCTCAGTCAACAAAGTTATTCTCGTCGGCAACCTGGGACGAGACCCCGAAGTACGTTACAGCCCCGATGGCGCAGC
CATTTGCAACGTTTCCATTGCCACCACCAGCACCTGGAAAGACAAGGCCTCGGGCGAAAAACGCGAAGAAACAGAATGGC
ATCGCGTGGTCTTTTATAACCGTCTGGCCGAAATTGCCGGCGAATATCTTAAAAAAGGCCGCTCCGTTTACGTCGAGGGC
CGTTTAAAGACCCGCAAATGGCAAGACAAAGACACTGGGGCTGACCGCTACAGCACTGATATCGTTGCCGATCAAATGCA
AATGCTGGGTGGTCGCGAAGGCGGCGATGCCAGCATGGGTGGTGGCACCGAATACAACCAGGCGCCTGCACAGCAGCGCA
GCCAGCGCCCAGCCCAGCCGCGTCCGGCCGCGCCCCAGGCATCGCCTGCAGCGAACCTGGCTGATATGGATGATGATATT
CCGTTTTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (4-109)

3D structure

• AlphaFold DB: F4GWZ8

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssb	Vibrio cholerae strain A1552	56.044	100	0.63
ssb	Neisseria gonorrhoeae MS11	52.841	100	0.574
ssb	Neisseria meningitidis MC58	52.273	100	0.568
ssb	Glaesserella parasuis strain SC1401	49.727	100	0.562