Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | GOY09_RS06680 | Genome accession | NZ_CP046590 |
| Coordinates | 1294550..1295068 (+) | Length | 172 a.a. |
| NCBI ID | WP_086043613.1 | Uniprot ID | A0A1W7AER1 |
| Organism | Macrococcoides canis strain LI021 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1269255..1325759 | 1294550..1295068 | within | 0 |
Gene organization within MGE regions
Location: 1269255..1325759
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GOY09_RS06560 (GOY09_06540) | gyrA | 1269255..1271906 (-) | 2652 | WP_211552423.1 | DNA gyrase subunit A | - |
| GOY09_RS06565 (GOY09_06545) | gyrB | 1271934..1273862 (-) | 1929 | WP_211552424.1 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
| GOY09_RS06570 (GOY09_06550) | recF | 1273870..1274979 (-) | 1110 | WP_210152331.1 | DNA replication/repair protein RecF | - |
| GOY09_RS06575 (GOY09_06555) | yaaA | 1274976..1275197 (-) | 222 | WP_086041414.1 | S4 domain-containing protein YaaA | - |
| GOY09_RS06580 (GOY09_06560) | - | 1275336..1275752 (-) | 417 | WP_086041413.1 | disulfide oxidoreductase | - |
| GOY09_RS06585 (GOY09_06565) | - | 1275752..1276456 (-) | 705 | WP_211552425.1 | DsbA family protein | - |
| GOY09_RS06590 (GOY09_06570) | - | 1276546..1277787 (-) | 1242 | WP_138070121.1 | ABC transporter permease | - |
| GOY09_RS06595 (GOY09_06575) | - | 1277780..1278676 (-) | 897 | WP_211552426.1 | ABC transporter ATP-binding protein | - |
| GOY09_RS06600 (GOY09_06580) | dnaN | 1278775..1279908 (-) | 1134 | WP_164941326.1 | DNA polymerase III subunit beta | - |
| GOY09_RS06605 (GOY09_06585) | dnaA | 1280083..1281420 (-) | 1338 | WP_164941325.1 | chromosomal replication initiator protein DnaA | - |
| GOY09_RS06610 (GOY09_06590) | rpmH | 1281893..1282030 (+) | 138 | WP_041636245.1 | 50S ribosomal protein L34 | - |
| GOY09_RS06615 (GOY09_06595) | rnpA | 1282129..1282476 (+) | 348 | WP_133420191.1 | ribonuclease P protein component | - |
| GOY09_RS06620 (GOY09_06600) | jag | 1282493..1283236 (+) | 744 | WP_233455620.1 | RNA-binding cell elongation regulator Jag/EloR | - |
| GOY09_RS06625 (GOY09_06605) | mnmE | 1283358..1284737 (+) | 1380 | WP_138072890.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE | - |
| GOY09_RS06630 (GOY09_06610) | mnmG | 1284750..1286624 (+) | 1875 | WP_138072888.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG | - |
| GOY09_RS06635 (GOY09_06615) | rsmG | 1286625..1287341 (+) | 717 | WP_164954007.1 | 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG | - |
| GOY09_RS06640 (GOY09_06620) | noc | 1287371..1288210 (+) | 840 | WP_133420195.1 | nucleoid occlusion protein | - |
| GOY09_RS06645 (GOY09_06625) | - | 1288336..1289784 (+) | 1449 | WP_164954006.1 | carbon starvation protein A | - |
| GOY09_RS06650 (GOY09_06630) | - | 1289944..1290705 (+) | 762 | WP_086043619.1 | ParA family protein | - |
| GOY09_RS06655 (GOY09_06635) | - | 1290698..1291561 (+) | 864 | WP_211552427.1 | ParB/RepB/Spo0J family partition protein | - |
| GOY09_RS06660 (GOY09_06640) | - | 1291562..1292449 (+) | 888 | WP_211552428.1 | mechanosensitive ion channel family protein | - |
| GOY09_RS06665 (GOY09_06645) | - | 1292451..1292639 (+) | 189 | WP_138072882.1 | DUF951 domain-containing protein | - |
| GOY09_RS06670 (GOY09_06650) | ychF | 1292658..1293758 (+) | 1101 | WP_086043615.1 | redox-regulated ATPase YchF | - |
| GOY09_RS06675 (GOY09_06655) | rpsF | 1294235..1294525 (+) | 291 | WP_086043690.1 | 30S ribosomal protein S6 | - |
| GOY09_RS06680 (GOY09_06660) | ssbA | 1294550..1295068 (+) | 519 | WP_086043613.1 | single-stranded DNA-binding protein | Machinery gene |
| GOY09_RS06685 (GOY09_06665) | rpsR | 1295101..1295343 (+) | 243 | WP_041636240.1 | 30S ribosomal protein S18 | - |
| GOY09_RS06690 (GOY09_06670) | - | 1295663..1296220 (+) | 558 | WP_164942951.1 | YfbU family protein | - |
| GOY09_RS06695 (GOY09_06675) | - | 1296217..1296831 (-) | 615 | WP_211552429.1 | GNAT family N-acetyltransferase | - |
| GOY09_RS06700 (GOY09_06680) | - | 1296947..1297927 (-) | 981 | WP_164942949.1 | DUF2382 domain-containing protein | - |
| GOY09_RS06705 (GOY09_06685) | - | 1298431..1298664 (+) | 234 | Protein_1331 | xanthine phosphoribosyltransferase | - |
| GOY09_RS06710 (GOY09_06690) | - | 1298666..1299169 (+) | 504 | Protein_1332 | solute carrier family 23 protein | - |
| GOY09_RS06715 (GOY09_06695) | guaB | 1299216..1300685 (+) | 1470 | WP_138072870.1 | IMP dehydrogenase | - |
| GOY09_RS06720 (GOY09_06700) | guaA | 1300749..1302290 (+) | 1542 | WP_133420208.1 | glutamine-hydrolyzing GMP synthase | - |
| GOY09_RS06725 (GOY09_06705) | - | 1302453..1303418 (-) | 966 | WP_164942948.1 | Abi family protein | - |
| GOY09_RS06730 (GOY09_06710) | - | 1303599..1303793 (-) | 195 | Protein_1336 | tyrosine-type recombinase/integrase | - |
| GOY09_RS06735 (GOY09_06715) | - | 1303880..1304059 (-) | 180 | WP_101038410.1 | hypothetical protein | - |
| GOY09_RS06740 (GOY09_06720) | spn | 1304296..1304601 (-) | 306 | WP_211552430.1 | SPIN family peroxidase inhibitor | - |
| GOY09_RS06745 (GOY09_06725) | - | 1304988..1305356 (+) | 369 | WP_211552431.1 | nuclear transport factor 2 family protein | - |
| GOY09_RS06755 (GOY09_06735) | treP | 1305676..1307148 (+) | 1473 | WP_138072819.1 | PTS system trehalose-specific EIIBC component | - |
| GOY09_RS06760 (GOY09_06740) | treC | 1307231..1308868 (+) | 1638 | WP_211552432.1 | alpha,alpha-phosphotrehalase | - |
| GOY09_RS06765 (GOY09_06745) | treR | 1308918..1309646 (+) | 729 | WP_138072815.1 | trehalose operon repressor | - |
| GOY09_RS06775 (GOY09_06755) | dnaX | 1310119..1311759 (+) | 1641 | WP_164942943.1 | DNA polymerase III subunit gamma/tau | - |
| GOY09_RS06780 (GOY09_06760) | - | 1311776..1312096 (+) | 321 | WP_086043586.1 | YbaB/EbfC family nucleoid-associated protein | - |
| GOY09_RS06785 (GOY09_06765) | recR | 1312098..1312694 (+) | 597 | WP_086043585.1 | recombination mediator RecR | - |
| GOY09_RS06790 (GOY09_06770) | - | 1312849..1313700 (+) | 852 | WP_086043580.1 | patatin family protein | - |
| GOY09_RS06810 (GOY09_06790) | - | 1319087..1320478 (+) | 1392 | WP_211552433.1 | aminotransferase class V-fold PLP-dependent enzyme | - |
| GOY09_RS06815 (GOY09_06795) | tmk | 1320492..1321106 (+) | 615 | WP_188019525.1 | dTMP kinase | - |
| GOY09_RS06820 (GOY09_06800) | - | 1321140..1321469 (+) | 330 | WP_086043577.1 | cyclic-di-AMP receptor | - |
| GOY09_RS06825 (GOY09_06805) | - | 1321517..1322440 (+) | 924 | WP_211552434.1 | DNA polymerase III subunit delta' C-terminal domain-containing protein | - |
| GOY09_RS06830 (GOY09_06810) | - | 1322437..1323237 (+) | 801 | WP_138072805.1 | stage 0 sporulation family protein | - |
| GOY09_RS06835 (GOY09_06815) | yabA | 1323249..1323584 (+) | 336 | WP_086043574.1 | DNA replication initiation control protein YabA | - |
| GOY09_RS06840 (GOY09_06820) | - | 1323622..1324350 (+) | 729 | WP_164953989.1 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | - |
| GOY09_RS06845 (GOY09_06825) | - | 1324343..1324597 (+) | 255 | WP_138072801.1 | GIY-YIG nuclease family protein | - |
| GOY09_RS06850 (GOY09_06830) | rsmI | 1324594..1325430 (+) | 837 | WP_164942937.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| GOY09_RS06855 (GOY09_06835) | - | 1325472..1325759 (-) | 288 | WP_099482735.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
Sequence
Protein
Download Length: 172 a.a. Molecular weight: 19028.60 Da Isoelectric Point: 4.8835
>NTDB_id=405738 GOY09_RS06680 WP_086043613.1 1294550..1295068(+) (ssbA) [Macrococcoides canis strain LI021]
MLNRVVLVGRLTKDPEYRVTTSGVSVATFTLAVNRTFTNAQGERQADFINCVVFRKQAENVNNFLHKGSLAGVDGRLQSR
SYDNQEGRRVYVTEVVCDSVQFLEPKNANQSRSNNPSDDYSSYDQGSYGQTQGQNQNYQASNNQQSNTSAPSNNPFANAT
GPIDISDDDLPF
MLNRVVLVGRLTKDPEYRVTTSGVSVATFTLAVNRTFTNAQGERQADFINCVVFRKQAENVNNFLHKGSLAGVDGRLQSR
SYDNQEGRRVYVTEVVCDSVQFLEPKNANQSRSNNPSDDYSSYDQGSYGQTQGQNQNYQASNNQQSNTSAPSNNPFANAT
GPIDISDDDLPF
Nucleotide
Download Length: 519 bp
>NTDB_id=405738 GOY09_RS06680 WP_086043613.1 1294550..1295068(+) (ssbA) [Macrococcoides canis strain LI021]
TTGCTTAACCGAGTTGTATTAGTTGGTCGTTTAACGAAAGATCCAGAATACAGAGTCACAACATCAGGTGTGTCAGTCGC
TACATTCACTTTAGCAGTAAATCGTACATTTACAAATGCCCAAGGAGAACGTCAAGCTGATTTTATCAACTGTGTCGTAT
TCCGTAAGCAAGCTGAAAATGTCAACAATTTCTTGCACAAAGGTAGCTTAGCTGGGGTTGATGGCAGATTGCAATCACGT
AGTTATGATAATCAAGAAGGACGTAGAGTATATGTAACAGAAGTGGTTTGTGATTCAGTTCAATTCCTTGAACCGAAAAA
TGCAAATCAATCACGTTCAAATAATCCGTCTGATGACTATTCAAGCTATGACCAAGGTAGTTATGGTCAGACGCAAGGTC
AGAATCAAAATTATCAAGCATCAAACAATCAACAATCAAATACATCAGCACCATCAAATAACCCATTTGCGAATGCAACA
GGGCCAATTGATATCAGTGATGATGATTTACCATTCTAA
TTGCTTAACCGAGTTGTATTAGTTGGTCGTTTAACGAAAGATCCAGAATACAGAGTCACAACATCAGGTGTGTCAGTCGC
TACATTCACTTTAGCAGTAAATCGTACATTTACAAATGCCCAAGGAGAACGTCAAGCTGATTTTATCAACTGTGTCGTAT
TCCGTAAGCAAGCTGAAAATGTCAACAATTTCTTGCACAAAGGTAGCTTAGCTGGGGTTGATGGCAGATTGCAATCACGT
AGTTATGATAATCAAGAAGGACGTAGAGTATATGTAACAGAAGTGGTTTGTGATTCAGTTCAATTCCTTGAACCGAAAAA
TGCAAATCAATCACGTTCAAATAATCCGTCTGATGACTATTCAAGCTATGACCAAGGTAGTTATGGTCAGACGCAAGGTC
AGAATCAAAATTATCAAGCATCAAACAATCAACAATCAAATACATCAGCACCATCAAATAACCCATTTGCGAATGCAACA
GGGCCAATTGATATCAGTGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
59.669 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
53.107 |
100 |
0.547 |
| ssb | Vibrio cholerae strain A1552 |
34.759 |
100 |
0.378 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
61.628 |
0.366 |