Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   GM698_RS10250 Genome accession   NZ_CP046532
Coordinates   2133423..2133875 (+) Length   150 a.a.
NCBI ID   WP_209289403.1    Uniprot ID   -
Organism   Mannheimia sp. ZY171111     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2099356..2139652 2133423..2133875 within 0


Gene organization within MGE regions


Location: 2099356..2139652
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GM698_RS10000 (GM698_09935) - 2099356..2099952 (+) 597 WP_159630058.1 DedA family protein -
  GM698_RS10005 (GM698_09940) - 2100637..2101671 (-) 1035 WP_209289374.1 phage portal protein -
  GM698_RS10010 (GM698_09945) - 2101680..2103482 (-) 1803 WP_209289808.1 terminase ATPase subunit family protein -
  GM698_RS10015 (GM698_09950) - 2103636..2104460 (+) 825 WP_209289375.1 GPO family capsid scaffolding protein -
  GM698_RS10020 (GM698_09955) - 2104476..2105504 (+) 1029 WP_209289376.1 phage major capsid protein, P2 family -
  GM698_RS10025 (GM698_09960) - 2105514..2106185 (+) 672 WP_209289377.1 terminase endonuclease subunit -
  GM698_RS10030 (GM698_09965) - 2106295..2106810 (+) 516 WP_209289378.1 head completion/stabilization protein -
  GM698_RS10035 (GM698_09970) - 2106810..2107022 (+) 213 WP_176808496.1 tail protein X -
  GM698_RS10040 (GM698_09975) - 2107044..2107247 (+) 204 WP_176808495.1 HP1 family phage holin -
  GM698_RS10045 (GM698_09980) - 2107247..2107774 (+) 528 WP_209289379.1 lysozyme -
  GM698_RS10050 (GM698_09985) - 2107776..2108231 (+) 456 WP_209289380.1 hypothetical protein -
  GM698_RS10820 lysC 2108125..2108355 (+) 231 WP_371739895.1 Rz1-like lysis system protein LysC -
  GM698_RS10055 (GM698_09990) - 2108380..2108601 (+) 222 WP_176808492.1 TraR/DksA family transcriptional regulator -
  GM698_RS10060 (GM698_09995) - 2108598..2109083 (+) 486 WP_176808491.1 phage tail protein -
  GM698_RS10065 (GM698_10000) - 2109076..2109540 (+) 465 WP_176808490.1 phage virion morphogenesis protein -
  GM698_RS10070 (GM698_10005) - 2109568..2109846 (-) 279 WP_176808489.1 hypothetical protein -
  GM698_RS10630 - 2110234..2112939 (+) 2706 WP_371739923.1 tape measure protein -
  GM698_RS10080 (GM698_10015) - 2113565..2114221 (+) 657 WP_245189267.1 BRO family protein -
  GM698_RS10085 (GM698_10020) - 2114294..2114473 (+) 180 WP_209289381.1 hypothetical protein -
  GM698_RS10090 (GM698_10025) - 2114466..2114753 (+) 288 WP_209289382.1 type II toxin-antitoxin system RelE/ParE family toxin -
  GM698_RS10095 (GM698_10030) - 2114880..2115449 (+) 570 WP_209289383.1 phage baseplate assembly protein V -
  GM698_RS10100 (GM698_10035) - 2115449..2115784 (+) 336 WP_176808480.1 GPW/gp25 family protein -
  GM698_RS10105 (GM698_10040) - 2115781..2116698 (+) 918 WP_209289384.1 baseplate J/gp47 family protein -
  GM698_RS10110 (GM698_10045) - 2116688..2117230 (+) 543 WP_176808478.1 phage tail protein I -
  GM698_RS10635 - 2117232..2119553 (+) 2322 WP_245189268.1 phage tail protein -
  GM698_RS10130 (GM698_10065) - 2119562..2120236 (+) 675 WP_245189269.1 DUF4376 domain-containing protein -
  GM698_RS10135 (GM698_10070) - 2120220..2120489 (+) 270 WP_209289385.1 hypothetical protein -
  GM698_RS10140 (GM698_10075) - 2120597..2121778 (+) 1182 WP_209289386.1 phage tail sheath protein -
  GM698_RS10145 (GM698_10080) - 2121788..2122294 (+) 507 WP_209289387.1 phage major tail tube protein -
  GM698_RS10150 (GM698_10085) - 2122360..2122671 (+) 312 WP_176808473.1 phage tail assembly protein -
  GM698_RS10155 (GM698_10090) - 2122704..2122811 (+) 108 WP_371739924.1 GpE family phage tail protein -
  GM698_RS10160 (GM698_10095) - 2122876..2123313 (+) 438 WP_209289388.1 phage tail protein -
  GM698_RS10165 (GM698_10100) - 2123313..2124545 (+) 1233 WP_209289389.1 phage late control D family protein -
  GM698_RS10170 (GM698_10105) - 2124545..2124919 (+) 375 WP_209289390.1 hypothetical protein -
  GM698_RS10175 (GM698_10110) - 2125069..2126247 (-) 1179 WP_209289391.1 hypothetical protein -
  GM698_RS10180 (GM698_10115) - 2126274..2126546 (-) 273 WP_209289392.1 excalibur calcium-binding domain-containing protein -
  GM698_RS10185 (GM698_10120) yidD 2126566..2126787 (-) 222 WP_371739896.1 membrane protein insertion efficiency factor YidD -
  GM698_RS10190 (GM698_10125) - 2126774..2127010 (-) 237 WP_209289394.1 DUF4177 domain-containing protein -
  GM698_RS10195 (GM698_10130) - 2127049..2127714 (-) 666 WP_209289395.1 S24 family peptidase -
  GM698_RS10200 (GM698_10135) - 2127847..2128275 (+) 429 WP_209289396.1 hypothetical protein -
  GM698_RS10205 - 2128337..2128495 (+) 159 WP_209289397.1 hypothetical protein -
  GM698_RS10210 (GM698_10140) - 2128483..2128632 (+) 150 WP_209289398.1 YdaS family helix-turn-helix protein -
  GM698_RS10215 (GM698_10145) - 2128689..2129099 (-) 411 WP_209289399.1 hypothetical protein -
  GM698_RS10220 (GM698_10150) - 2129239..2129511 (+) 273 WP_159630130.1 hypothetical protein -
  GM698_RS10225 (GM698_10155) - 2129594..2129923 (+) 330 WP_176808461.1 hypothetical protein -
  GM698_RS10230 (GM698_10160) - 2129933..2130226 (+) 294 WP_159630132.1 hypothetical protein -
  GM698_RS10235 (GM698_10165) - 2130287..2130550 (+) 264 WP_209289400.1 hypothetical protein -
  GM698_RS10240 (GM698_10170) - 2130534..2130866 (+) 333 WP_209289401.1 hypothetical protein -
  GM698_RS10245 (GM698_10175) - 2130863..2133235 (+) 2373 WP_209289402.1 replication endonuclease -
  GM698_RS10250 (GM698_10180) ssb 2133423..2133875 (+) 453 WP_209289403.1 single-stranded DNA-binding protein Machinery gene
  GM698_RS10255 (GM698_10185) - 2133907..2134218 (+) 312 WP_245189270.1 DUF6378 domain-containing protein -
  GM698_RS10260 (GM698_10190) - 2134208..2134477 (+) 270 WP_209289405.1 hypothetical protein -
  GM698_RS10265 (GM698_10195) - 2134452..2134742 (+) 291 WP_209289406.1 hypothetical protein -
  GM698_RS10270 (GM698_10200) - 2134742..2134936 (+) 195 WP_209289407.1 hypothetical protein -
  GM698_RS10275 (GM698_10205) - 2134970..2135149 (-) 180 WP_209289408.1 ribbon-helix-helix protein, CopG family -
  GM698_RS10280 (GM698_10210) - 2135428..2136426 (-) 999 WP_209289409.1 site-specific integrase -
  GM698_RS10290 (GM698_10220) apaH 2136791..2137603 (-) 813 WP_209289410.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
  GM698_RS10295 (GM698_10225) - 2137676..2139652 (-) 1977 WP_209289411.1 exoribonuclease II -

Sequence


Protein


Download         Length: 150 a.a.        Molecular weight: 17124.57 Da        Isoelectric Point: 8.8996

>NTDB_id=405190 GM698_RS10250 WP_209289403.1 2133423..2133875(+) (ssb) [Mannheimia sp. ZY171111]
MNLVTLIGRLGQDPDIRTMQNGEKVAVLSVATTEKWTDKQTGVKKESTEWHRVVLYRRLAEIAELYVKKGHLVSIIGKIK
TRKWTDSNGVERSITEIIAEQMQMLSSGEKNTPNKAENKPQPKQKNQDVMTADEQKDIPQFDDDICKQPF

Nucleotide


Download         Length: 453 bp        

>NTDB_id=405190 GM698_RS10250 WP_209289403.1 2133423..2133875(+) (ssb) [Mannheimia sp. ZY171111]
ATGAATTTAGTTACATTAATCGGTCGATTGGGGCAAGACCCTGATATTAGAACAATGCAAAACGGTGAGAAAGTTGCGGT
TTTATCGGTAGCAACAACAGAAAAATGGACGGATAAGCAAACTGGCGTGAAGAAAGAAAGCACCGAATGGCATAGGGTGG
TGCTTTATCGCCGATTAGCTGAAATTGCCGAATTGTATGTAAAAAAAGGGCATTTGGTATCAATTATCGGGAAAATTAAA
ACCCGAAAATGGACGGATAGCAACGGTGTTGAGCGGAGTATTACAGAGATTATTGCCGAGCAGATGCAAATGCTAAGTAG
TGGTGAGAAAAATACGCCAAATAAGGCAGAAAATAAACCGCAACCAAAGCAGAAAAATCAAGACGTGATGACTGCGGACG
AGCAGAAAGATATTCCTCAGTTTGATGATGATATATGCAAACAACCTTTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

42.391

100

0.52

  ssb Vibrio cholerae strain A1552

42.286

100

0.493

  ssb Neisseria gonorrhoeae MS11

49.107

74.667

0.367

  ssb Neisseria meningitidis MC58

49.107

74.667

0.367


Multiple sequence alignment